(data stored in ACNUC7421 zone)

EMBL: AE006468.PE346

AE006468.PE346       Location/Qualifiers
FT   CDS_pept        401890..403143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0356"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC77235.1); Blastp hit to AAC77235.1 (425 aa), 28%
FT                   identity in aa 33 - 412"
FT                   /db_xref="EnsemblGenomes-Gn:STM0356"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19310"
FT                   /db_xref="GOA:Q8ZRG4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG4"
FT                   /protein_id="AAL19310.1"
FT                   /translation="MYTPLNWTTTQRHVAFACFTSWMLDAFDFFILVFVLSDLAEWFHA
FT                   SVSDVSIAIMLTLAVRPIGALLFGRMAEKYGRRPILMLNILFFTVFELLSAWSPTFMAF
FT                   LIFRVMYGVAMGGIWGVASSLAMETIPDRSRGLMSGIFQAGYPCGYLFASVIFGLFYSM
FT                   VGWRGMFLIGALPVVLLPYIWFKVPESPVWLAARARKENTALLPVLRKQWKLCLYLVLV
FT                   MAFFNFFSHGTQDLYPTFLKMQHGFDPHLISIIAIFYNIAAMLGGIFYGTLSERIGRKK
FT                   AIMIAAFLALPVLPLWAFSSGSFTIGLGAFLMQFMVQGAWGVVPTWLNELVPANARAVL
FT                   PGFVYQLGNLLASVNATLQARIAETHGGNYGLAMAIVAGAVAILICVFVAFGRETRGVV
FT                   ISGTDSDALPESAISHRT"
     atgtacaccc ccctgaactg gacgacgaca caacgacatg tggcgtttgc ctgctttacc        60
     agttggatgc tggatgcgtt tgatttcttt atccttgtct ttgtacttag cgatctcgcc       120
     gaatggtttc acgcttccgt atcggacgtt tccattgcga ttatgctgac cctggcggta       180
     cgtcccattg gcgcgctgct atttggccga atggcggaaa agtacggacg tcgaccgata       240
     ctgatgctca atattctgtt ttttacggtg tttgaactgc tttccgcctg gtcgcccacc       300
     ttcatggcat ttctgatttt tcgggtcatg tacggcgtgg cgatgggcgg gatatggggc       360
     gtcgcgtcat cactggcgat ggaaaccatt cccgatcgtt cgcgtggcct gatgtcgggc       420
     atttttcagg cgggctatcc ctgcggctat ctgttcgcct cggttatttt tggcctcttc       480
     tacagtatgg taggctggcg cggtatgttc ctgattggcg ccctgcctgt tgtcttgctg       540
     ccttatatct ggtttaaagt gccggaatcc cccgtctggc tggcggccag agcgcgtaaa       600
     gagaataccg cgctgcttcc tgttctgcgc aaacagtgga agttgtgtct gtatctggtg       660
     ctggtcatgg cgttctttaa ctttttcagt cacggtacgc aggatctcta tcctaccttc       720
     ctgaagatgc agcatggttt tgatccgcat ctgatcagta tcattgcaat tttttataac       780
     attgccgcca tgctcggcgg tattttctac ggtacgctat cggaacgtat tgggcgtaaa       840
     aaagcgatca tgatcgccgc ctttcttgcg cttccggtac tcccgctatg ggcattttcc       900
     agcggatcat tcacgattgg tctgggcgcg ttcctgatgc agtttatggt gcagggcgcc       960
     tggggtgtcg tgccgacctg gctgaacgag ctggttccgg cgaatgcgcg cgccgtgctg      1020
     ccagggtttg tttaccaact cggtaattta ctggcgtcgg ttaatgcgac gttacaggcc      1080
     cgcatcgcgg aaacgcatgg tggcaattac gggttggcaa tggcgatcgt ggctggcgcg      1140
     gtggctattt taatctgtgt atttgtggca tttggtcgcg agacccgggg agtcgtcatc      1200
     tccggtacag atagcgacgc cctcccggag tcggccatca gtcatcgcac gtaa            1254
//

If you have problems or comments...

PBIL Back to PBIL home page