(data stored in ACNUC7421 zone)

EMBL: AE006468.PE349

AE006468.PE349       Location/Qualifiers
FT   CDS_pept        408549..408650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0359"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0359"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19313"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR50"
FT                   /protein_id="AAL19313.1"
FT                   /translation="MLNRYYRFAVEKDDPSEAPESGDKPDSQPQKKS"
     atgctaaata gatactaccg tttcgctgtc gaaaaagacg acccctccga agcgccagag        60
     tcgggcgata agcctgacag ccagccgcaa aaaaaatcgt aa                          102
//

If you have problems or comments...

PBIL Back to PBIL home page