(data stored in ACNUC7421 zone)

EMBL: AE006468.PE350

AE006468.PE350       Location/Qualifiers
FT   CDS_pept        408767..410170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0360"
FT                   /product="cytochrome BD2 subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.2.1.41"
FT                   /note="similar to E. coli probable third cytochrome
FT                   oxidase, subunit I (AAC74063.1); Blastp hit to AAC74063.1
FT                   (514 aa), 38% identity in aa 2 - 316, 38% identity in aa
FT                   381 - 512"
FT                   /db_xref="EnsemblGenomes-Gn:STM0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19314"
FT                   /db_xref="GOA:Q8ZRG3"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG3"
FT                   /protein_id="AAL19314.1"
FT                   /translation="MEFDAFFLARLQFAFTVSFHIIFPAITIGLASYLVVLEGLWLKTR
FT                   NPVWRSLYQFWLKIFAVNFGMGVVSGLVMAYQFGTNWSGFSQFAGSITGPLLTYEVLTA
FT                   FFLEAGFLGVMLFGWNKVGPGLHFLSTCMVALGTLMSTFWILASNSWMHTPQGFEIHNG
FT                   QVVPVDWFAVIFNPSFPYRLLHMSVAAFLSSAMFVGASAAWHLLKGNDTPAIRRMFSMA
FT                   LWMAVVVAPVQALIGDMHGLNTLKHQPVKIAAIEGHWENTPGEPTPLTLVGWPDMEAER
FT                   TRYALEIPALGSLILTHSLDKQVPALKDYPKEDRPNSTVVFWSFRLMVGMGVLMIFLGL
FT                   ASLWLRYRRRLYHSRPFMHFALWMGPSGLIAILAGWVTTEVGRQPWVVYGLLRTRDAVS
FT                   AHSTLQMSISLLAFFVVYSLVFGVGYIYMIRLIQKGPQPAETPTAETDGRPARPISAVG
FT                   ESLEQEKRE"
     atggagtttg atgccttctt tttagcgaga ctccagtttg cctttaccgt ctcttttcat        60
     attattttcc ccgcgattac gattggctta gccagttacc tggtggtact ggaaggttta       120
     tggctaaaaa cgcgtaatcc tgtctggcgc tcgctctatc agttctggct caaaattttt       180
     gccgtcaact tcgggatggg cgtggtctcc ggtctggtca tggcttacca gttcggaacg       240
     aactggagcg gtttttccca gttcgccggc agtatcaccg ggcctttatt aacctatgaa       300
     gtgctcaccg cattcttcct ggaagcggga ttcttaggcg tgatgctttt tggctggaac       360
     aaagtcgggc cgggtctgca tttcttgtct acctgtatgg tggcgttggg cacgttaatg       420
     tcgacgttct ggattctggc gtctaacagc tggatgcata ccccgcaggg atttgaaatt       480
     cacaacggtc aggtagtccc ggtggactgg ttcgcggtga ttttcaaccc gtcgttcccg       540
     tatcgcctgt tgcatatgtc cgttgcggcg tttttaagta gcgcgatgtt tgtcggcgcg       600
     tccgctgcct ggcatttact gaaaggtaac gatacgccgg ctatccgccg tatgttctcg       660
     atggcgttat ggatggcggt cgtggtggcg cccgttcagg cattgattgg cgatatgcat       720
     ggccttaaca ccctgaagca tcagccggtc aaaatcgccg cgattgaggg gcactgggaa       780
     aatacgcccg gcgagccaac gccgcttacg ctggtaggct ggccggatat ggaggcggaa       840
     cggacccgct atgcgcttga gatcccggcg ttgggcagtc tgatcctgac gcatagcctg       900
     gacaaacagg tgcctgcgct aaaagattat cccaaagagg atcgccccaa ctctaccgtg       960
     gtgttctggt ctttccgtct gatggtgggc atgggcgtac tgatgatctt cctggggctg      1020
     gccagcctgt ggctacgcta ccgacgccga ctgtatcatt cgcggccctt tatgcacttt      1080
     gcgctgtgga tggggccgtc cgggcttatc gccatccttg ccggatgggt gacgacggaa      1140
     gtaggacgcc agccgtgggt ggtctatggc ctgctgcgaa cgcgtgatgc ggtttccgcg      1200
     cacagtacct tgcagatgag catcagtttg ctggccttct ttgtggtcta ttccctggtc      1260
     tttggggttg gctatattta tatgattcgc cttatccaga aagggccgca gccggcggag      1320
     acaccgaccg ctgaaaccga tggcagaccc gcgcgtccta tctctgccgt gggagaatcg      1380
     cttgagcagg agaaacgcga atga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page