(data stored in ACNUC7421 zone)

EMBL: AE006468.PE351

AE006468.PE351       Location/Qualifiers
FT   CDS_pept        410167..411177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0361"
FT                   /product="cytochrome BD2 subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /EC_number="1.2.1.41"
FT                   /note="similar to E. coli cytochrome d terminal oxidase
FT                   polypeptide subunit II (AAC73828.1); Blastp hit to
FT                   AAC73828.1 (379 aa), 34% identity in aa 7 - 221, 22%
FT                   identity in aa 121 - 366"
FT                   /db_xref="EnsemblGenomes-Gn:STM0361"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19315"
FT                   /db_xref="GOA:Q8ZRG2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRG2"
FT                   /protein_id="AAL19315.1"
FT                   /translation="MTIDLPVIWFAIIVFATLMYIVMDGFDLGVGILFPFIRDKHDRDV
FT                   MVNSVAPVWDGNETWLVLGGAGLFGAFPLAYAVITDALTIPLVVMLLGLIFRGVAFEFR
FT                   FKATESHRAFWDKSFIVGSILATFAQGVVVGAVVSGFQVEGRTFSGSQLDWLTPFNLFC
FT                   GVGLVVTYALLGATWLIMKSEDPLHSRMCALSRPLLIVLLLVMGGVSVWTPLTHDDIAE
FT                   RWFTLPNLYYFLPVPVLVLAFSVWLWRSVKKPESHARPFILTLGLIFLGFSGLGISIWP
FT                   NIIPPDISLYAAAAPPQSQSFMLVGALIIIPIILAYTFWSYYVFRGKVRHGEGYH"
     atgaccatcg atcttccggt tatctggttt gctattatcg tgttcgccac gctgatgtat        60
     atcgtaatgg atgggttcga tctgggcgtc ggtatcctgt ttccgtttat tcgtgataaa       120
     cacgatcgcg atgttatggt gaactcagtc gcgccggtat gggacgggaa cgaaacctgg       180
     ctggtgctgg gcggggccgg gctttttggc gcgttcccgt tggcttatgc cgtcatcacc       240
     gacgcgctga ctatcccgct ggtggttatg ctgcttggtc ttatctttcg cggcgtcgct       300
     tttgaattcc gttttaaagc caccgagtcg catcgcgcgt tctgggataa atcctttatc       360
     gtcgggtcaa tcctggcgac ctttgcccag ggggttgtgg tgggcgcggt ggtgagcggt       420
     tttcaggtgg aagggcgaac ctttagcggt tcgcagcttg actggctgac gccgtttaac       480
     ctgttctgcg gcgtcggtct ggttgtcacc tacgcgctgc tgggcgctac ctggctgatt       540
     atgaaaagcg aagatccgct gcatagccgg atgtgcgcgc tgtcgcgccc gttgttgatc       600
     gtcttgttgt tggtgatggg aggcgtcagc gtgtggacgc cgctcaccca cgacgacatc       660
     gccgagcgct ggttcacgct gcccaattta tactacttcc tgccggtgcc tgtgctggtg       720
     ttggctttta gcgtctggct atggcgcagc gtgaaaaaac cagaatccca tgcgcgtcca       780
     tttattctca cgctagggct gatttttctg gggttcagcg ggttaggcat cagtatttgg       840
     ccgaatatta ttccaccgga tatttcgctg tatgccgccg ccgcgccgcc gcaaagtcaa       900
     agctttatgc tggttggggc gctgataatc atcccgatta ttctggctta taccttctgg       960
     agctactacg tcttccgtgg aaaagtgcga catggtgagg gatatcactg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page