(data stored in ACNUC7421 zone)

EMBL: AE006468.PE371

AE006468.PE371       Location/Qualifiers
FT   CDS_pept        434716..435429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0381"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19335"
FT                   /db_xref="GOA:Q8ZRF2"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF2"
FT                   /protein_id="AAL19335.1"
FT                   /translation="MFMGCENGGRVRGKGFLIIVLLGGIGGLGYRYLPSYYNPFAPLQL
FT                   ADPPGWITTFKLQRLTPSQCRELLTAANQQGLISSQPVADSAGECPLSHVVRVRDFGQV
FT                   KLSSSFLASCPLALRSALFVEQQAKPLTETWMKRRLTRIEHLGSYACRNIYHRPDARRS
FT                   EHASAEALDVSGFQLSDGRKITVLRGWGRQETGPWLRAMLNASCHYYGNGLGPDYNAAH
FT                   ANHFHLGMRGYGVCR"
     atgtttatgg gatgtgagaa cggaggccgc gtgagaggta agggttttct gattattgtg        60
     ctgttgggcg gcattggcgg gctgggatat cgttatcttc cctcttatta taatcctttt       120
     gctccgctac aacttgccga tccgccaggc tggatcacta ccttcaaact acagcgcctg       180
     acgccgtcgc agtgccggga gcttttgacg gcggccaatc aacagggatt aatttcatca       240
     caacctgttg cggatagcgc tggtgaatgt cccttatccc atgttgtgcg cgtcagagat       300
     tttggccagg taaaactgag cagcagtttt ttagcctcct gcccgttggc gctgcgctcc       360
     gcgctgtttg tcgaacagca ggcaaaacct ttaacagaaa cgtggatgaa gcgccgcctg       420
     acccgtatcg aacatctggg cagctatgcc tgccgtaata tttatcaccg cccggatgcg       480
     cgtcgcagtg aacatgccag cgcagaagcg ctggatgtca gcgggtttca gctatcggat       540
     ggccgaaaaa tcactgtcct gcgcggctgg gggcgtcagg agacggggcc ctggttacgc       600
     gctatgttaa acgccagttg ccattattat ggcaatgggc tcgggcctga ctataacgct       660
     gcgcatgcta accattttca tcttggaatg cggggctacg gcgtgtgtcg ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page