(data stored in ACNUC7421 zone)

EMBL: AE006468.PE372

AE006468.PE372       Location/Qualifiers
FT   CDS_pept        435598..436809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0382"
FT                   /product="putative permease"
FT                   /note="similar to E. coli putative transport protein
FT                   (AAC74137.1); Blastp hit to AAC74137.1 (408 aa), 60%
FT                   identity in aa 11 - 405"
FT                   /db_xref="EnsemblGenomes-Gn:STM0382"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19336"
FT                   /db_xref="GOA:Q8ZRF1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRF1"
FT                   /protein_id="AAL19336.1"
FT                   /translation="MESWKVNLISVWFGCFFTGLAISQILPFLPLYISQLGVSSHEALS
FT                   MWSGLTFSITFLISAIVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATHVWQLFL
FT                   LRGIMGLTSGYIPNAMALVASQVPRERSGWALSTLSTAQISGVIGGPLMGGFVADHIGL
FT                   RAVFLITAMLLVVSFLVTLFLIKEGVRPVIKKSERLSGKAVFASLPYPALVISLFFTTM
FT                   VIQLCNGSISPILALFIKSMMPDSNNIAFLSGLIASVPGISALISAPRLGKLGDRIGTE
FT                   RILMATLICAVLLFFAMSWVTTPFQLGLLRFLLGFADGAMLPAVQTLLVKYSSDQITGR
FT                   IFGYNQSFMYLGNVVGPLMGATVSAMAGFRWVFIATAAIVLINIGQLTLALRRRRNAQK
FT                   AKGQ"
     atggaatcct ggaaagttaa tctaatttcc gtttggtttg gatgtttttt taccgggctg        60
     gcaatcagcc aaatcctgcc attcttaccc ctttatattt cccagcttgg cgtctcttcc       120
     catgaagcgt tatcaatgtg gtccgggtta acgtttagca tcacgtttct tatttccgcc       180
     attgtgtcgc cgatgtgggg cagtctcgcc gatcgtaaag ggcgtaaact gatgctattg       240
     cgcgcgtcgc tcgggatggc gatagctatt ctactgcagg catttgcgac ccatgtctgg       300
     caacttttcc tgctgcgcgg aatcatgggg ttaacgtcag gctatatccc caatgccatg       360
     gcgctggtag cctctcaggt accacgcgaa cgtagcggct gggcgctcag tacgctttct       420
     accgcgcaga tcagcggcgt tatcggcggg ccgttaatgg gcggctttgt cgcggatcat       480
     atcgggctgc gggcggtatt tctgattacc gccatgctgt tggtggtgag ctttctggtc       540
     acgctatttt taattaaaga aggcgtgcgt ccggtcatca agaaaagcga acgcctgagc       600
     ggtaaagccg tttttgcgtc gttaccttat cctgcgctgg tgatcagttt gttttttacc       660
     acgatggtca ttcaactctg taatggttcc atcagtccaa tcctggcgct gtttatcaaa       720
     tcaatgatgc cggacagtaa taacatcgcc tttcttagcg ggttaattgc ctcggtgccc       780
     ggtatctctg cgcttatctc cgcgcctcgc ctgggaaaac ttggcgacag aatcggcacg       840
     gaaagaattc tgatggccac gcttatctgc gcagtgctgc ttttcttcgc gatgtcctgg       900
     gtcaccacgc cgttccagct ggggctgtta cgtttcttgt taggctttgc cgatggcgcg       960
     atgttacccg ccgtacaaac gttattggtg aaatactcca gcgatcaaat taccggacgt      1020
     atttttggct acaaccagtc atttatgtac ctgggcaacg tggttgggcc gttgatgggc      1080
     gcgacggtat cggcgatggc cggtttccgc tgggttttta tcgctacggc ggcgatcgtg      1140
     ttgatcaata tcgggcaact gaccctggcg ttacgtcgtc ggcgtaacgc gcaaaaagcg      1200
     aaaggccaat ag                                                          1212
//

If you have problems or comments...

PBIL Back to PBIL home page