(data stored in ACNUC7421 zone)

EMBL: AE006468.PE399

AE006468.PE399       Location/Qualifiers
FT   CDS_pept        465309..465674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0409"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19363"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR38"
FT                   /protein_id="AAL19363.1"
FT                   /translation="MKNLINWFEIPVTDMARAIAFYEQVMQISLRRETMDGADLAVFPY
FT                   AEPGPGGALIKQDDVAPVAQGVVIYLHTADLLASIERVVLAGGKCVLEPMVPGDDIGTI
FT                   ALFIDSEGNRIGLHQPA"
     atgaaaaact tgattaactg gtttgaaatt ccagttactg atatggcgcg tgcaatcgcc        60
     ttttatgagc aagtgatgca gatatcgtta cgtcgggaaa ccatggatgg ggcggacctg       120
     gccgtattcc cgtatgctga acccggaccc ggcggagcgc tgataaagca ggatgatgtc       180
     gctccagttg cgcagggagt cgttatttat ctgcataccg ccgatttgtt agcctcgatt       240
     gaacgtgtcg tccttgccgg tggcaagtgt gttctggaac ccatggttcc cggagatgac       300
     attggaacca tcgcgttgtt tattgacagc gaaggcaacc gaataggttt acatcaacct       360
     gcgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page