(data stored in ACNUC7421 zone)

EMBL: AE006468.PE400

AE006468.PE400       Location/Qualifiers
FT   CDS_pept        465700..466392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0410"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0410"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19364"
FT                   /db_xref="GOA:Q7CR37"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR37"
FT                   /protein_id="AAL19364.1"
FT                   /translation="MTRRADRLFQIVQILRGRRLTTAALLAQRLAVSERTIYRDIRDLS
FT                   LSGVPVEGEAGSGYRLMAGFDLPPLMLTHRESEALMVAIRLLKTWGGDSLSRELESAQE
FT                   KVLAILPEESRRKAEQTRIYAPDLGTSPHSRSAFDLIHQAVSAQQVLALHYRDEAGHLS
FT                   SRDIQPLGLFFWGEHWLLVAWCERREDYRCFRLDRCLQITPLNRRFRETIDRSLRDFLR
FT                   KVEHEKMP"
     atgaccagac gcgctgaccg tttgtttcag atcgtgcaaa ttttgcgggg tagacgactg        60
     acgacggcag cgctgttggc acagcggctt gcggtttctg aacggacgat ttatcgcgat       120
     attcgcgatc tgtcgttatc cggtgtgcct gtcgaaggtg aagcggggag cggataccgt       180
     ttaatggcag gttttgatct gccacccttg atgcttaccc atcgtgaatc ggaagcactg       240
     atggtggcta tacggttatt gaaaacctgg ggcggcgatt cgctatcacg cgagcttgaa       300
     tccgcccagg aaaaagtgtt ggccattttg ccggaagaga gccgccgtaa agcggagcag       360
     acacggattt acgctccgga tttgggtaca tctccacatt cgcgcagcgc gtttgatctt       420
     atccatcagg ccgtttcggc gcagcaggtg ttggcgctac attatcgtga tgaagcgggg       480
     catctctctt cgcgggatat acaaccgctg ggattgtttt tctggggaga gcactggctg       540
     ctggttgcct ggtgtgagag acgggaagac tatcggtgtt ttcgcctcga tcgctgttta       600
     caaattactc cgcttaaccg gcgatttcgt gaaacaatcg accgttcttt gcgtgatttt       660
     ttgcgaaaag tcgagcacga aaaaatgccg taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page