(data stored in ACNUC7421 zone)

EMBL: AE006468.PE402

AE006468.PE402       Location/Qualifiers
FT   CDS_pept        complement(467157..467483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0412"
FT                   /product="putative inner membrane protein"
FT                   /note="hypothetical protein 14.5K (gi|1073681)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0412"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19366"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR36"
FT                   /protein_id="AAL19366.1"
FT                   /translation="MRRRVAPTSHYFRRCHQPKNRPVAIPTSVGAARSCQIVMLNSVSV
FT                   ILPPLLQWQRFAAILNLSGVKLAPVMLPVNTEQCAGVFSFQRQGHRGSSPRNIAPHRVA
FT                   PAYR"
     atgcggcggc gagtcgcgcc cacttcacat tacttccggc gatgccacca gcctaaaaac        60
     agacctgtcg caatcccgac cagcgttggt gccgccagat cgtgccagat agtaatgctc       120
     aactctgtga gcgtcatatt gccgcctttg ttgcaatggc aacggttcgc ggctatcctc       180
     aacttgtctg gagtcaagtt agcccccgta atgttgccgg tgaataccga acaatgtgcg       240
     ggggttttct ctttccagcg acaaggccac cggggatcaa gcccccgcaa cattgcgcct       300
     caccgggttg ccccggctta ccgctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page