(data stored in ACNUC7421 zone)

EMBL: AE006468.PE41

AE006468.PE41        Location/Qualifiers
FT   CDS_pept        complement(48372..50411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0041"
FT                   /product="putative glycosyl hydrolase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76680.1); Blastp hit to AAC76680.1 (772 aa), 25%
FT                   identity in aa 116 - 547, 27% identity in aa 549 - 665, 25%
FT                   identity in aa 84 - 149"
FT                   /db_xref="EnsemblGenomes-Gn:STM0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19005"
FT                   /db_xref="GOA:Q8ZRZ2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRZ2"
FT                   /protein_id="AAL19005.1"
FT                   /translation="MPFMQQDPRRLVWQQNDRYLWIEPWGENSLRVRSGRHLPVMRNED
FT                   WALTEPVAESQCHIDYEHHQATLTNGKIIAIVNQKGQVTFYRHPHKPLLQEFWRLRGEI
FT                   GEDESSHGQYVSALNLEGREFRPIQGGKYSLKARFEATEGEKIYGMGQYQQANLDLKGC
FT                   VLELAQRNSQASVPFMLSSLGYGFLWNNPAVGRVTFAQNVTEWEAQVSEQLDYWITAGD
FT                   TPAEISRAYALATGTPPMMPDYAMGFWQCKLRYRTQEELLEVAREYKRRNLPISVIVID
FT                   FFHWPNQGDWMFDARDWPDPDAMIAELKSLGIELMVSVWPTVDNRTESYREMRENGWLV
FT                   QTERGLPINMDFLGNTTYFDATHPGARDYVWGKAKRNYYDKGVKLFWLDEAEPEFSVYD
FT                   YDNYRYHAGPVLEVGNIYPRMYAKTFFDGMKADGEDQVINLLRCAWAGSQKYGALVWSG
FT                   DIHSSFRSLRNQFAAGLNMGIAGIPWWTTDIGGFHGGNIHDPKFHELLIRWFQWGVFSP
FT                   VMRLHGNRDPQILPAQPYRDGIAQCPTGAPNEVWSYGEEVCEVLTGCLALREKLKPYIK
FT                   ALMEETHKHNTPVMRPLFFEFPEQETSWTITDQYCFGPDLLIAPVMHEGMRERDVWLPE
FT                   GETWTDLATGESYSGGQTLQYATPLNRIPVFIREGGQYRSLLNL"
     atgccattta tgcaacaaga cccgcgtcgt ctggtctggc agcaaaacga tcgctattta        60
     tggattgaac cctggggcga gaacagcctg cgcgtacgca gcggccgtca tctgccggta       120
     atgagaaatg aagactgggc attgactgag ccagtcgcag aaagtcagtg ccacattgat       180
     tatgagcacc accaggcaac gctgaccaac ggcaaaatta tcgctatcgt caatcaaaaa       240
     ggacaggtta ccttttaccg ccatccacac aaacccctgt tgcaggagtt ctggcgcctg       300
     cggggcgaaa ttggcgagga tgaatcatct cacggccagt acgtcagcgc actcaacctt       360
     gagggacgcg agttccgccc tattcagggt gggaaatatt cactgaaagc ccgcttcgaa       420
     gccaccgaag gggaaaaaat ttatggcatg gggcagtatc aacaggccaa cctggatctc       480
     aaaggatgcg tgcttgagct ggcgcaacgt aactcccagg cctcagtacc gtttatgctc       540
     tccagtctgg gctacggatt tttatggaac aacccggcag tcggacgcgt aacctttgcc       600
     caaaacgtta ccgaatggga agcgcaggtc agcgaacagc tggactactg gatcacggct       660
     ggcgataccc cggcagaaat tagccgggct tacgcgctgg ctaccggcac accgccgatg       720
     atgccggact acgccatggg cttctggcag tgcaaactcc gttatcgtac gcaggaagag       780
     ctgctggagg tcgcccgcga atataagcgc cgcaatctgc ctatctcagt gatcgtaatc       840
     gacttctttc actggccgaa tcagggtgac tggatgttcg atgcgcgcga ctggcccgat       900
     cctgatgcca tgattgccga gctgaaatcg ctgggaattg agctgatggt ctccgtctgg       960
     ccgacggtgg ataaccgtac cgaaagctat cgggagatgc gcgaaaacgg ctggctggta      1020
     caaacggaac gtggcttgcc gatcaatatg gatttcctcg gcaataccac ttactttgat      1080
     gcgactcatc cgggcgcgcg cgactacgtc tggggcaaag ccaaacgcaa ctattacgat      1140
     aaaggcgtga agttattctg gttagatgaa gccgaacctg agttcagcgt ttacgactac      1200
     gacaactatc gctaccatgc cgggccggta ctggaagtgg gcaatatcta cccacgtatg      1260
     tacgctaaaa ccttttttga cggcatgaaa gccgatggcg aagaccaggt tatcaacctg      1320
     ctacgctgcg cctgggccgg cagtcagaag tacggcgctc tggtctggtc aggggatatt      1380
     cactcctcgt ttagatcgct gcgcaaccag tttgctgccg gactcaatat gggaatcgcg      1440
     gggataccgt ggtggacgac ggatatcggc ggttttcatg gtggcaatat tcacgacccg      1500
     aaattccatg aattgctgat tcgctggttc cagtggggcg tctttagccc ggtgatgcgt      1560
     ctgcacggca accgcgatcc gcagatttta cccgcacaac cgtatcggga tggtatcgcc      1620
     cagtgcccta caggtgcgcc gaacgaggtc tggagctacg gtgaggaagt atgcgaggta      1680
     ctgacaggtt gcctggcgtt gcgagaaaaa ctcaagccct atatcaaagc gctgatggag      1740
     gaaacccata agcacaatac gccagtgatg cgccccctgt tctttgaatt ccccgaacag      1800
     gaaacaagtt ggacaatcac cgaccagtat tgttttggtc ctgacctgct gatcgccccc      1860
     gtcatgcatg aaggtatgcg cgaacgtgat gtctggctac cagaagggga aacatggacg      1920
     gatcttgcga ccggtgaaag ctattcagga gggcagacgc tgcagtacgc tacgccactg      1980
     aacagaattc cggtgtttat ccgcgaaggt gggcagtacc gtagcctgct gaacttgtag      2040
//

If you have problems or comments...

PBIL Back to PBIL home page