(data stored in ACNUC7421 zone)

EMBL: AE006468.PE429

AE006468.PE429       Location/Qualifiers
FT   CDS_pept        491990..493273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0438"
FT                   /product="putative TPR repeat protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73748.1); Blastp hit to AAC73748.1 (184 aa), 35%
FT                   identity in aa 77 - 179, 33% identity in aa 56 - 171"
FT                   /db_xref="EnsemblGenomes-Gn:STM0438"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19393"
FT                   /db_xref="GOA:Q8ZRC5"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRC5"
FT                   /protein_id="AAL19393.1"
FT                   /translation="MDIPQAIKYYEQACDLDGDYGCFNAAYFYEYGIGTQKDITQAKTL
FT                   AKQLREKINLSNINLDKKVSERIIGSVYSNKLEAYRDLSFRPHFIQGLSFYFYAPQSDE
FT                   RKLLSRIGFDSSHLARIAILWAREGDPEVAYQTAKLVSTLYFNNETKTIDIAEALKWLR
FT                   ISAEKGDADSQTLLGFLYEHAGLGLQPDGEKARKWYEMAAQQGNGEALYTLGRMYYSGV
FT                   LVNVDYDKALYFFKKAYEKKLQEAADYLAQMYFNGQSVDVDCQQSWHYYDNSYIKKMTQ
FT                   RDYLDYCEKDRKRRNDFNQQLPELTLEKYAGLFGRIDNIPLCQIGFVVNTNKLIHVANL
FT                   RVELILKNDAGVSDERMVAFPPLGLNTLGAEQGMGDSFKSMGYLLMKNGDLCDYHKLTF
FT                   TVKSATATINGKKVDLLKTDNLHIIQNR"
     gtggatattc cgcaagcaat aaagtactac gagcaggctt gtgatttgga cggtgattat        60
     ggttgcttta atgcggctta tttctatgaa tatggcatcg gtacccaaaa ggacattacg       120
     caagcgaaaa cattagcaaa acagcttaga gaaaaaatta atctatccaa tatcaatctc       180
     gataaaaagg tgagtgaacg tataattggg agtgtttata gtaataaact tgaggcatat       240
     agagaccttt catttcgtcc tcattttatt caaggcttaa gtttctattt ttatgccccg       300
     caatcagatg agcgaaaact gctgagtcga ataggttttg actcatcaca tcttgcgcgg       360
     atagcgatac tctgggcgag agagggtgat cctgaggtcg cgtatcagac ggcaaaactg       420
     gtctctactt tgtattttaa taatgaaacg aaaacgatag atattgctga agcgctgaaa       480
     tggctccgaa tttcggccga gaagggggat gccgactcac agacgctgtt aggttttctt       540
     tatgaacacg ccggattggg attacaacca gatggagaga aagcccggaa atggtatgaa       600
     atggcggcgc agcaaggtaa tggagaagca ttgtatacgt taggtcgtat gtactattct       660
     ggcgtactgg ttaacgttga ttacgataag gcgctgtatt tttttaaaaa agcttatgag       720
     aaaaaattac aggaggccgc tgattattta gcacagatgt attttaatgg ccagagtgta       780
     gatgtcgatt gccaacaatc ctggcactat tacgataaca gctatataaa aaagatgaca       840
     caacgcgatt atcttgatta ttgtgaaaaa gatcgaaagc gccgtaatga ttttaatcag       900
     caacttcctg agctgacatt agaaaaatat gcgggattat ttggcaggat tgataatatt       960
     cctctgtgtc agattggatt tgttgtcaat acgaataagt taattcatgt tgcgaactta      1020
     cgtgtggaat tgatattaaa aaatgatgct ggagttagtg acgaaagaat ggtcgctttt      1080
     cctcctttgg gtctcaatac tctgggtgct gaacagggta tgggggattc ttttaagtcg      1140
     atgggatatc tcttgatgaa aaacggtgac ttgtgtgatt accataaact tactttcacc      1200
     gtgaagtcag cgacggcaac aatcaatggt aaaaaagttg atttactgaa aacggataat      1260
     ttacatatta ttcagaatcg ataa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page