(data stored in ACNUC7421 zone)

EMBL: AE006468.PE53

AE006468.PE53        Location/Qualifiers
FT   CDS_pept        complement(61794..63413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0053"
FT                   /product="putative transcription regulator"
FT                   /note="histidine kinase for citrate; similar to E. coli
FT                   putative sensor-type protein (AAC73720.1); Blastp hit to
FT                   AAC73720.1 (552 aa), 42% identity in aa 12 - 538"
FT                   /db_xref="EnsemblGenomes-Gn:STM0053"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19017"
FT                   /db_xref="GOA:Q8ZRY5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRY5"
FT                   /protein_id="AAL19017.1"
FT                   /translation="MFIREITRWFARHSFQNRIFLLILFTSTIVMLAITWYLTDITKER
FT                   LHYQVGQRALIQAMQISAMPELVEAVEAHDLSRIKALIDPMRSFSDATYITVGNEKGQR
FT                   LYHVNPDEIGKYMEGGDSDDALYNAKSYVSVRKGSLGSSLRGKSPIQDSTGKVIGIVSV
FT                   GYTLEQLESWLNLQISSLLFPMALLLLVLLYCARRFSLHIKKQMLNMEPQQLSQLLIQQ
FT                   SVLFESVFEGLIAIDSHHRITAINQTARRLLNLSQPESELIGYAIHHVVLPEAFFYDAP
FT                   QKNKKDEIVTFNQMKVIASRMAVIIDNQPQGWVISFRNKDDINTLSLQLSQVRQYADNL
FT                   RAVQHEHRNLISTIAGLLFLKRYDNALALIQQQSESHQKVLDFISHNFRDHHLAGLLIG
FT                   KYYRAKELGLELIFDPSSFVEHLPSSLSHNEWISIVGNLLDNAYNATLLNREGSRQIEC
FT                   LINSEGNEVIIEVADQGCGIDENIRQHIFERGVTTHNNGDHGIGLWLVHSYVKQANGDI
FT                   IVDNNNPFGTIFTLYIPFTREE"
     atgtttatac gggaaattac acgctggttt gccagacact cgtttcaaaa ccggatattt        60
     ctactgatcc tgtttacatc caccatcgtg atgctggcaa tcacctggta tctgaccgat       120
     atcacgaaag aacgcctgca ttatcaggtg ggccaacgtg cgcttattca ggcaatgcaa       180
     atatccgcta tgccagaatt agttgaagcc gtagaagcgc atgatttgtc acgcatcaaa       240
     gcgttgattg acccaatgcg ctcgttttcg gatgcgactt acattaccgt tggcaacgaa       300
     aaaggtcagc gactgtatca cgtcaacccg gatgagatcg gcaaatatat ggagggcggc       360
     gatagcgacg acgcgctgta taacgctaaa agctacgtat cggtgcgcaa aggttcatta       420
     ggctcttccc tacgtggtaa atccccgatt caggacagta ccggtaaagt catcggtatt       480
     gtttccgtcg gctatactct ggaacagttg gagagctggc ttaacttaca aatcagctcg       540
     ttgctgttcc cgatggcgtt actgctgctg gtactgttgt actgtgcccg ccgcttctcg       600
     ctgcatatta aaaagcagat gcttaacatg gagccgcagc agctttcaca actattaatt       660
     cagcaaagcg tgttatttga gtcggtattt gaagggttga tcgccattga ctcccatcac       720
     cgtattaccg ccattaacca aacggctcgc cgcttactga atctgagcca accggagtct       780
     gaactcattg gctatgcaat ccaccatgtc gtgttgccgg aggccttctt ttacgatgcg       840
     ccgcaaaaaa acaaaaaaga tgagatcgtc acctttaacc aaatgaaagt catcgccagt       900
     cgcatggcgg tcattattga caaccagcct cagggctggg ttattagctt tcgcaacaaa       960
     gacgatatca atacactcag cctgcagtta agtcaggtgc ggcaatacgc cgataacctg      1020
     cgcgccgtgc agcatgagca tcgcaacctt atttccacca ttgccggact gctgttcctg      1080
     aagcgctacg ataatgcgct ggcgctgatt cagcagcagt cggaaagcca ccagaaagta      1140
     ctcgatttta tttcccataa tttccgcgac caccaccttg cggggctatt aatcggtaaa      1200
     tattatcggg caaaagagct ggggctggag ctgattttcg atccttcaag ctttgttgaa      1260
     cacctgccgt catcgctctc gcataatgaa tggatttcga ttgttggcaa tttattggac      1320
     aacgcctata acgccaccct gctcaatcgc gaaggctcgc gacagattga gtgcctgatc      1380
     aacagcgaag gtaatgaagt cattattgaa gttgccgatc agggatgtgg tattgacgaa      1440
     aatatccgcc agcatatttt cgagcgtgga gtgaccaccc acaacaacgg cgatcacgga      1500
     attggattat ggttggtgca cagctacgtc aagcaggcca atggtgacat tatcgtcgat      1560
     aacaataatc cttttggcac catttttacc ctctatatcc cttttaccag agaagaataa      1620
//

If you have problems or comments...

PBIL Back to PBIL home page