(data stored in ACNUC7421 zone)

EMBL: AE006468.PE65

AE006468.PE65        Location/Qualifiers
FT   CDS_pept        75088..75435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0065"
FT                   /product="putative viral protein"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0065"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19029"
FT                   /db_xref="GOA:Q8ZRX7"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRX7"
FT                   /protein_id="AAL19029.1"
FT                   /translation="MRLIGPSDASVRVITFNGKKLLPELTLVIFSRSALPYAKGTSTRL
FT                   IRLISIGGGVLFLGGAFYLFCFNRLAFLCCSEAGCGPIVCACLKEKEAGSLYRDCNSYY
FT                   IVLICCFLLIL"
     atgcggttaa ttggcccttc agacgcatcg gtacgggtca ttacgttcaa cgggaaaaaa        60
     ttactgcctg aactgacgtt agtcatattc agccgcagcg ccttaccgta tgcaaaaggc       120
     acctcgacca gactgataag actgatatcc atcggagggg gagtgctgtt cctcgggggg       180
     gcgttttatc tcttttgctt caataggttg gcttttttat gctgtagtga ggctggttgt       240
     ggtccaatcg tatgtgcctg tcttaaagaa aaagaagctg gatctttata tcgcgattgt       300
     aattcttatt acattgtctt aatttgctgt tttttgttga ttttatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page