(data stored in ACNUC7421 zone)

EMBL: AE006468.PE82

AE006468.PE82        Location/Qualifiers
FT   CDS_pept        complement(94771..95061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0082"
FT                   /product="putative secreted protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76270.1); Blastp hit to AAC76270.1 (104 aa), 36%
FT                   identity in aa 18 - 103"
FT                   /db_xref="EnsemblGenomes-Gn:STM0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19046"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="PDB:2JNA"
FT                   /db_xref="PDB:2MA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR88"
FT                   /protein_id="AAL19046.1"
FT                   /translation="MKKRIIAAALLATVASFSTLAAEQVSKQEISHFKLVKVGTINVSQ
FT                   SGGQISSPSDLREKLSELADAKGGKYYHIIAAREHGPNFEAVAEVYNDATK"
     atgaaaaaac gcattattgc cgccgcatta ctggcaacgg ttgcttcatt cagcacactt        60
     gcggcagagc aggtctctaa acaagaaatc agccacttca aactggttaa ggtcggcacc       120
     ataaatgtgt cccagagtgg cggacagatt tcctcaccct ctgatctacg cgaaaaactg       180
     tcagaattag ccgatgcgaa aggcggaaaa tattaccata ttatcgctgc acgtgagcat       240
     ggtccgaatt ttgaagccgt tgccgaagtt tataacgatg cgacgaaata a                291
//

If you have problems or comments...

PBIL Back to PBIL home page