(data stored in ACNUC7421 zone)

EMBL: AE006468.PE98

AE006468.PE98        Location/Qualifiers
FT   CDS_pept        complement(115477..116097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="STM0098"
FT                   /product="putative secreted protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC76121.1); Blastp hit to AAC76121.1 (230 aa), 24%
FT                   identity in aa 19 - 171"
FT                   /db_xref="EnsemblGenomes-Gn:STM0098"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19062"
FT                   /db_xref="GOA:Q8ZRV6"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRV6"
FT                   /protein_id="AAL19062.1"
FT                   /translation="MKYRYIIRIAAGIILIMATVFIHNAIAIYQFSQQNQTRVADCAIV
FT                   AGAGVSGKTPSPVFQARLDHAIWLYQQHIVRALVLTGGYGAGATVSDAAIARQYVLEKG
FT                   IPAKAIFIEERSTVTRENIRYAKQILRQQQWRTALLVSDPLHMLRLKTIAQDNGIDSRS
FT                   SPTRSTRYKSWWAQTRFLLRETFYYSGYRLLRYMPVQNNSITP"
     atgaaatatc gctacatcat cagaatcgcg gcaggcataa ttctcattat ggctacggtg        60
     tttatccata atgccatcgc tatttatcag ttcagtcagc aaaaccagac gcgcgtagct       120
     gactgcgcga ttgtcgcagg agcaggcgtt agcggaaaaa cgccttctcc cgtttttcag       180
     gccagactgg atcatgccat ctggctttac caacaacaca ttgtccgcgc gttggtatta       240
     accggcggct acggcgctgg cgcaacggtt tccgacgcgg cgatagcccg tcaatacgtt       300
     ctggaaaaag ggattccggc taaggcaatt tttattgaag agcgctctac cgtgacgcgc       360
     gaaaatattc gttacgcaaa acagatactg cgacaacaac aatggcgcac agcgttactg       420
     gtcagcgatc cgctgcatat gctgcgtctg aaaactatcg ctcaggataa tggtatcgat       480
     agccgctcat cacccacgcg atccacccgc tataaatcct ggtgggcgca aacccgcttc       540
     ttactgcgag aaacttttta ttacagcgga tatcggcttt tacgttatat gcctgtacaa       600
     aataacagta ttacccccta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page