(data stored in ACNUC7421 zone)

EMBL: AE006468.PFS

AE006468.PFS         Location/Qualifiers
FT   CDS_pept        complement(242063..242761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="STM0207"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /EC_number="3.2.2.9"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73270.1); Blastp hit to AAC73270.1 (232 aa), 96%
FT                   identity in aa 1 - 232"
FT                   /db_xref="EnsemblGenomes-Gn:STM0207"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19171"
FT                   /db_xref="GOA:P60217"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:P60217"
FT                   /protein_id="AAL19171.1"
FT                   /translation="MKIGIIGAMEEEVTLLRDKIDNRQTITLGGCEIYTGQLNGTEVAL
FT                   LKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDEARYHDADVTA
FT                   FGYEYGQLPGCPAGFKADDKLIAAAESCIRELNLNAVRGLIVSGDAFINGSVGLAKIRH
FT                   NFPDAVAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTLMV
FT                   ETLVQKLAHG"
     atgaaaatcg gcatcattgg cgcaatggaa gaagaagtta cgctgctgcg tgacaaaatt        60
     gacaaccgtc agacgattac gctgggcggc tgcgaaattt acactggcca gttgaacggc       120
     accgaagtgg cgttgctgaa atccggtatc ggtaaagtcg cggcggcgct gggcgcaacg       180
     ttgcttctgg agcactgcaa gccggacgtg atcatcaata ccggttccgc aggcggtctg       240
     gcgtccacgc tgaaggtcgg cgatatcgtc gtctctgacg aagcgcgtta ccacgacgct       300
     gatgtgaccg ctttcggcta tgaatacggg caattaccgg gctgtccggc cggatttaag       360
     gccgatgaca aactgatcgc cgccgcggaa tcctgcatca gagagctgaa tctgaacgcg       420
     gtacgcggcc ttattgttag cggcgacgcg tttattaacg gttccgtcgg gctggcgaaa       480
     atccggcata acttccccga cgcggtcgcc gtagagatgg aagccaccgc tatcgcccac       540
     gtctgccata acttcaacgt gccgttcgtg gtggttcgcg ctatttctga cgtggccgat       600
     cagcaatcgc acctcagctt tgacgaattc ctcgcggtgg cggcgaaaca gtcgactctg       660
     atggtcgaaa cgctggtaca gaaactggcg catggctaa                              699
//

If you have problems or comments...

PBIL Back to PBIL home page