(data stored in ACNUC7421 zone)

EMBL: AE006468.PHOE

AE006468.PHOE        Location/Qualifiers
FT   CDS_pept        complement(364981..366033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoE"
FT                   /locus_tag="STM0320"
FT                   /product="outer membrane pore protein e (e,ic,nmpab)"
FT                   /note="outer membrane pore protein E precursor.
FT                   (SW:PHOE_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0320"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19276"
FT                   /db_xref="GOA:P30705"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30705"
FT                   /protein_id="AAL19276.1"
FT                   /translation="MNKSTLAIVVSIIASASVHAAEVYNKNGNKLDVYGKVKAMHYMSD
FT                   YDSKDGDQSYVRFGFKGETQINDQLTGYGRWEAEFASNKAESDSSQQKTRLAFAGLKLK
FT                   DIGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGIVD
FT                   GLDLTLQYQGKNEDRDVKKQNGDGFGTSVSYDFGGSDFAVSGAYTLSDRTREQNLQRRG
FT                   TGDKAEAWATGVKYDANDIYIATFYSETRNMTPVSGGFANKTQNFEAVIQYQFDFGLRP
FT                   SLGYVLSKGKDIEGVGSEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNTLGINDDD
FT                   IVAIGLTYQF"
     atgaataaaa gcactctggc aatagtggtg agtatcatcg catcagcatc tgttcacgcc        60
     gccgaggttt acaataaaaa cggtaataag cttgatgtgt atggaaaagt taaagccatg       120
     cactatatga gcgattatga cagcaaagat ggcgatcaaa gctacgttcg ttttggtttt       180
     aaaggcgaaa cgcaaattaa cgatcaattg accggctacg ggcgctggga agctgagttt       240
     gccagtaata aagccgaaag tgattcgtcc cagcaaaaaa cccgcctggc ctttgctggc       300
     ctgaaattaa aagatatcgg ttcttttgac tatggacgta acctgggcgc gctgtacgat       360
     gttgaggcct ggacggatat gtttcccgaa ttcggcggcg actcttccgc ccagaccgat       420
     aattttatga ctaaacgcgc cagcgggctg gcgacttacc gcaataccga tttcttcggc       480
     atcgttgatg gactggatct taccttacag tatcagggga aaaacgaaga tcgcgatgtg       540
     aaaaagcaaa acggcgacgg cttcggcaca tccgtgagct atgatttcgg cggcagcgat       600
     tttgccgtca gcggcgctta tactctctcc gatcgcacca gggagcaaaa tctgcagcgc       660
     cgcggtacgg gcgataaagc cgaagcctgg gctacgggtg ttaagtatga cgctaatgat       720
     atttatattg cgaccttcta ttcagaaacc cgcaacatga cgccagtttc cggcggattt       780
     gccaataaaa cccaaaactt cgaagcggtt atccagtatc agtttgattt tggtctgcgt       840
     ccgtcattag gctatgtgct gtcaaaaggc aaagatattg agggcgtcgg cagtgaggat       900
     ttggtgaatt acattgacgt tggcgcaacc tattacttca acaaaaatat gtccgcgttt       960
     gtagattaca aaatcaatca gcttgatagc gataacacgt taggcattaa tgacgatgat      1020
     attgtggcaa tagggttgac ctaccagttc tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page