(data stored in ACNUC7421 zone)

EMBL: AE006468.PPDD

AE006468.PPDD        Location/Qualifiers
FT   CDS_pept        complement(167714..168151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD"
FT                   /locus_tag="STM0144"
FT                   /product="prelipin peptidase dependent protein"
FT                   /note="putative major component of type IV pilin; similar
FT                   to E. coli prelipin peptidase dependent protein
FT                   (AAC73219.1); Blastp hit to AAC73219.1 (146 aa), 89%
FT                   identity in aa 1 - 146"
FT                   /db_xref="EnsemblGenomes-Gn:STM0144"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19108"
FT                   /db_xref="GOA:Q7CR79"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR79"
FT                   /protein_id="AAL19108.1"
FT                   /translation="MEKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGTSTCDAGVNGIPSPVITRYVSGMSVEKGVITLTGQESLSGLS
FT                   VIMTPAWDNANGITGWTRNCNIQSDSALQQACEDVFRFDAN"
     atggaaaaac aacgcggttt cacgcttatc gaactgatgg tcgttattgg catcatcgcc        60
     attttaagcg ccattggcat tccggcttac cagaactatc tgcgtaaagc ggcgctgacg       120
     gatatgttgc aaacgtttgt cccctaccgt actgccgtcg aactctgcgc tctggaacat       180
     ggtgggacga gcacatgcga tgcgggcgtc aacggtatcc cctcgcccgt catcacccgt       240
     tatgtttcgg gcatgagcgt ggaaaaaggc gtcatcacgc ttaccggcca ggagagtctg       300
     agcgggctta gcgtcatcat gacgcccgcc tgggacaatg ctaacggcat tactggctgg       360
     acgcgtaact gcaatattca aagcgacagc gcgttacaac aggcttgtga agatgtcttc       420
     cgttttgacg ccaactaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page