(data stored in ACNUC7421 zone)

EMBL: AE006468.PROB

AE006468.PROB        Location/Qualifiers
FT   CDS_pept        366316..367419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="STM0321"
FT                   /product="gamma-glutamate kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="similar to E. coli gamma-glutamate kinase
FT                   (AAC73346.1); Blastp hit to AAC73346.1 (367 aa), 96%
FT                   identity in aa 1 - 367"
FT                   /db_xref="EnsemblGenomes-Gn:STM0321"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19277"
FT                   /db_xref="GOA:P65792"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65792"
FT                   /protein_id="AAL19277.1"
FT                   /translation="MSDSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRI
FT                   VIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLT
FT                   RADMEDRERFLNARDTLRALLDNHIVPVINENDAVATAEIKVGDNDNLSALAAILAGAD
FT                   KLLLLTDQQGLFTADPRSNPQAELIKDVYGVDDALRSIAGDSVSGLGTGGMSTKLQAAD
FT                   VACRAGIDTIIASGSKPGVIGDVMEGISVGTRFHAQASPLENRKRWIFGAPPAGEITVD
FT                   EGATAAMLERGSSLLPKGIKSVTGNFSRGEVIRICNLQGRDIAHGVSRYNSDALRRIAG
FT                   HHSQQIDAILGYEYGPVAVHRDDMITR"
     atgagtgaca gccagacgct ggtcgtaaaa ctcggcacca gcgtgctaac aggcggatcg        60
     cgccgcctga accgtgccca tatcgtagaa cttgtccgcc agtgcgcgca gttacacgcc       120
     gcgggacatc gtattgttat tgttacctct ggcgcgattg ccgccggacg tgaacatctc       180
     ggctacccgg aactgccggc aacaattgcc tctaaacagc ttctggcggc ggtagggcaa       240
     agccgcttga ttcaactgtg ggagcagttg ttttcaattt acggtatcca tatcgggcag       300
     atgctgttga cgcgtgcgga tatggaagac agagagcgct ttctgaacgc ccgcgatacg       360
     ctacgtgcat tactggataa ccatattgtg ccggttatca atgaaaatga tgccgttgcg       420
     acagcggaaa ttaaagtggg cgacaacgat aacctctccg cgctggcggc gatcctggca       480
     ggcgcggata aactgctgct gctgaccgat cagcaaggat tatttaccgc cgatccgcgt       540
     agcaatccgc aggcggagct tatcaaagat gtgtatggcg ttgacgatgc gctgcgctct       600
     atcgcgggag acagcgtttc cgggctggga accggtggta tgagcactaa gcttcaggcg       660
     gcagacgtgg cctgtcgcgc gggtattgat acgattattg cctcaggcag taaaccgggc       720
     gtgatcggcg atgtgatgga ggggatttcc gtcggcaccc gttttcatgc gcaagcctcg       780
     ccgctggaaa accgcaaacg ttggatcttc ggcgcgccgc cggcaggtga aattacggtt       840
     gatgaaggcg cgaccgcggc aatgctggaa cgtggcagtt cacttctgcc aaaaggcatc       900
     aaaagcgtga cgggcaattt ctcgcggggg gaggtcatca gaatttgtaa cctgcaaggg       960
     cgtgatattg ctcatggcgt cagccgttat aacagtgatg ctctgcggcg gatagccggt      1020
     caccactctc aacaaatcga tgcgattctg ggctatgaat atggcccggt cgctgttcat      1080
     cgtgatgaca tgattactcg ataa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page