(data stored in ACNUC7421 zone)

EMBL: AE006468.PRPD

AE006468.PRPD        Location/Qualifiers
FT   CDS_pept        420197..421648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpD"
FT                   /locus_tag="STM0370"
FT                   /product="putative protein in propionate catabolism"
FT                   /note="PRPD protein. (SW:PRPD_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19324"
FT                   /db_xref="GOA:P74840"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR012705"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/Swiss-Prot:P74840"
FT                   /protein_id="AAL19324.1"
FT                   /translation="MSTQELNIRPDFDREIVDIVDYVMNYEITSKVAYDTAHYCLLDTL
FT                   GCGLEALEYPACKKLLGPIVPGTVVPNGARVPGTQFQLDPVQAAFNIGAMIRWLDFNDT
FT                   WLAAEWGHPSDNLGGILATADWLSRNAVAAGKAPLTMKQVLSGMIKAHEIQGCIALENA
FT                   FNRVGLDHVLLVKVASTAVVAEMLGLTRDEILNAVSLAWVDGQSLRTYRHAPNTGTRKS
FT                   WAAGDATSRAVRLALMAKTGEMGYPSALTAKTWGFYDVSFKGETFRFQRPYGSYVMENV
FT                   LFKISFPAEFHSQTAVEAAMTLYEQMQAAGKTAADIEKVTIRTHEACLRIIDKKGPLNN
FT                   PADRDHCIQYMVAVPLLFGRLTAADYEDEVAQDKRIDALREKIVCYEDPAFTADYHDPE
FT                   KRAIGNAITVEFTDGSRFGEVVVEYPIGHARRRADGIPKLIEKFKINLARQFPTRQQQR
FT                   ILDVSLDRARLEQMPVNEYLDLYVI"
     atgtctaccc aagaactgaa catccgccca gactttgacc gtgaaatcgt tgatatcgtt        60
     gattacgtta tgaattacga gatcacctca aaggtggcgt acgacaccgc gcattattgc       120
     ctgctcgaca cgctcggttg tggtctggaa gcgctggaat acccggcctg taaaaaattg       180
     cttgggccaa tcgtgccagg cacggtggtg cccaacggcg cacgcgtgcc gggcacccag       240
     ttccagctcg atccggtaca ggcagctttt aacattggcg cgatgatccg ctggcttgat       300
     tttaacgata cctggcttgc cgccgagtgg ggccatcctt ctgataacct cggcggtatt       360
     ctggcgacgg ctgactggct gtcacgcaac gccgtcgccg ccggcaaagc gccgctgacc       420
     atgaaacagg tattgagcgg gatgatcaaa gcccatgaaa ttcagggctg catcgcgctg       480
     gaaaacgcct tcaaccgtgt cggacttgac catgtgttgc tggtgaaagt ggcctcgact       540
     gcggtggtcg ctgaaatgct ggggctgacg cgcgatgaga tcctcaacgc ggtatcgctg       600
     gcgtgggtgg atgggcagtc gctgcgtacc tatcgtcatg cgccgaatac cggtacgcgc       660
     aaatcctggg cggcgggcga tgcgacttcg cgcgcggtac gtctggcgct gatggcgaaa       720
     accggcgaga tgggctatcc ctcggcgctc accgccaaaa cctggggctt ctacgacgtt       780
     tcattcaaag gtgaaacgtt ccgtttccag cgtccttacg gctcctacgt gatggaaaac       840
     gtgctattca aaatttcttt cccggcagaa ttccactcgc aaaccgccgt cgaagcggcg       900
     atgacgctgt atgagcagat gcaggccgcg ggtaaaacgg cagcggatat cgagaaagtg       960
     accatccgca cccacgaagc ctgtctccgc attatcgata aaaaaggccc gctcaataac      1020
     ccggcggacc gcgatcactg tatccagtat atggtcgccg tgccgctgct gttcggacgg      1080
     ttaaccgcgg cggattatga agacgaggtg gcgcaggaca agcgtattga cgccctgcgc      1140
     gagaagatcg tgtgttatga ggacccggct tttaccgccg actatcacga cccggaaaaa      1200
     cgagctatcg gcaatgcgat caccgtggag tttactgatg gatcacgctt tggcgaggtt      1260
     gtcgtggagt atccgattgg tcatgcgcgt cgccgcgccg acggtattcc gaagcttatc      1320
     gaaaaattta aaattaacct ggcgcgtcag ttcccgactc gccagcagca acgcattctg      1380
     gatgtctccc tggacagagc ccgcctggag cagatgccgg ttaacgaata cctcgattta      1440
     tatgtcatct ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page