(data stored in ACNUC7421 zone)

EMBL: AE006468.PYRH

AE006468.PYRH        Location/Qualifiers
FT   CDS_pept        256277..257002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="STM0218"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="similar to E. coli uridylate kinase (AAC73282.1);
FT                   Blastp hit to AAC73282.1 (241 aa), 98% identity in aa 1 -
FT                   241"
FT                   /db_xref="EnsemblGenomes-Gn:STM0218"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19182"
FT                   /db_xref="GOA:P65933"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65933"
FT                   /protein_id="AAL19182.1"
FT                   /translation="MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELV
FT                   ELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLATVMNGLAMRDALHRAYVNARL
FT                   MSAIPLNGVCDNYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEADVVLK
FT                   ATKVDGVFTADPAKDPSATMYDQLTYSEVLDKELKVMDLAAFTLARDHKLPIRVFNMNK
FT                   PGALRRVVMGEKEGTLITE"
     atggctacca atgcaaaacc cgtctataaa cgcattctgc ttaaattaag cggcgaagct        60
     ctgcagggta cggaaggctt cggtattgat gcaagcatac tggatcgtat ggctcaggag       120
     atcaaagaac tggttgaact gggtattcag gttggtgtgg tgattggcgg tggtaacctg       180
     ttccgtggcg cgggtctggc aaaagcgggg atgaaccgcg ttgtgggcga ccacatgggc       240
     atgttggcca ccgtcatgaa cggcctggca atgcgtgatg cgcttcaccg cgcctatgtg       300
     aacgcccgcc tgatgtcggc aattccttta aacggcgtgt gcgacaacta cagttgggcc       360
     gaggcgatta gcctgctgcg taataaccgt gttgtgattc tgtctgcagg tacgggtaac       420
     ccgttcttca ctaccgactc tgcggcttgt ctgcgcggga tcgaaattga agcggatgtc       480
     gtactgaaag cgaccaaagt ggatggcgta ttcactgccg atccggcaaa agatccttcc       540
     gcgaccatgt acgatcagct gacctacagc gaagtgctgg ataaagagct gaaagtgatg       600
     gatctggcgg cgttcacgct ggctcgtgac cacaaactgc cgattcgtgt tttcaacatg       660
     aacaaaccgg gcgcgctgcg tcgtgtggtg atgggcgaaa aagaagggac gttaatcacg       720
     gaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page