(data stored in ACNUC7421 zone)

EMBL: AE006468.RDGC

AE006468.RDGC        Location/Qualifiers
FT   CDS_pept        complement(442930..443841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="STM0392"
FT                   /product="putative exonuclease involved in removal of
FT                   stalled replication fork"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73496.1); Blastp hit to AAC73496.1 (303 aa), 93%
FT                   identity in aa 1 - 303"
FT                   /db_xref="EnsemblGenomes-Gn:STM0392"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19346"
FT                   /db_xref="GOA:P65973"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65973"
FT                   /protein_id="AAL19346.1"
FT                   /translation="MLWFKNLMVYRLSRDITLRAEEMEKQLASMTFTPCGSQDMAKMGW
FT                   VPPMGSHSDALTHTANGQIIICARKEEKILPSPVIKQALEAKIQKLEADQGRKLKKTEK
FT                   DSLKDEVLHSLLPRAFSRFSQTMMWIDTVNGLIMVDCASAKKAEDTLALLRKSLGSLPV
FT                   VPLALENPIELTLTEWVRSGTVAQGFQLLDEAELKAMLEDGGVIRAKKQDLVSDEIAVH
FT                   IEAGKVVTKLALDWQQRIQFVMCDDGSIKRLKFCDELRDQNEDIDREDFAQRFDADFIL
FT                   MTGELAALIQSLVEGLGGEAQR"
     atgctgtggt tcaaaaattt aatggtttac cgtcttagcc gcgatattac attacgcgcc        60
     gaagagatgg agaaacagct cgcctcaatg acgtttaccc catgcggtag ccaggatatg       120
     gccaaaatgg gctgggttcc gccgatgggc tctcacagcg atgcgttaac gcacaccgcc       180
     aatggccaaa ttattatttg cgcgcgcaaa gaagagaaaa tcctgccatc gccagtgatc       240
     aaacaggcac tggaggcgaa aatccagaaa ctggaagccg atcagggacg caagctgaag       300
     aagacggaaa aagattccct gaaggatgaa gtgttgcatt cgttgctgcc gcgcgcgttt       360
     agccgcttca gtcagacaat gatgtggatt gataccgtta acggcctgat tatggttgac       420
     tgcgccagcg cgaaaaaagc ggaagatact ttggcgctac tgcgtaaaag tcttggctcg       480
     ctgccggtcg tcccgctggc gctggaaaat ccgattgagc tgacgctcac cgagtgggtg       540
     cgctccggta cggtcgctca gggtttccag ttgctggacg aagccgaatt gaaagcgatg       600
     ctggaagatg gcggcgtgat ccgcgcgaaa aagcaggatc tggtcagcga cgagatcgcc       660
     gttcatattg aagcgggtaa agtggtcacg aagctggcgc tcgactggca gcagcgcatt       720
     caattcgtca tgtgcgatga cggctccatt aagcgtctga aattctgcga tgagctgcgc       780
     gaccagaacg aagatatcga ccgggaagat tttgcccaac gttttgacgc ggactttatc       840
     ctgatgaccg gcgagctggc ggcgctgatt caaagcctgg tggaaggatt aggcggcgaa       900
     gcgcagcgct aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page