(data stored in ACNUC7421 zone)

EMBL: AE006468.RECR

AE006468.RECR        Location/Qualifiers
FT   CDS_pept        543213..543818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="STM0486"
FT                   /product="putative recombination protein, gap repair"
FT                   /note="similar to E. coli recombination and repair
FT                   (AAC73574.1); Blastp hit to AAC73574.1 (201 aa), 96%
FT                   identity in aa 1 - 201"
FT                   /db_xref="EnsemblGenomes-Gn:STM0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19440"
FT                   /db_xref="GOA:P65992"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65992"
FT                   /protein_id="AAL19440.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLASEKISELILATNPTVEGEATANYIAELCAE
FT                   AGVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIIF"
     atgcaaacca gtccgctgtt aactcagctt atggaagcgt tgcgctgcct tccgggcgtt        60
     ggccctaagt cggcgcagcg gatggcgttt accctgttgc agcgcgatcg cagcggcgga       120
     atgcgcctgg cgcaggcgct gactcgggcg atgtcggaaa tcggccactg cgccgactgc       180
     cgcaccttta ccgagcagga tgtttgtaat atctgctcga acccgcggcg tcaggaaaac       240
     ggccagattt gcgtggtgga gagtcctgcg gatatctacg ccattgagca gaccgggcaa       300
     ttttccgggc ggtatttcgt gctgatgggc cacctgtcgc cgctggacgg catcgggccg       360
     gatgatatcg gtcttgatcg tctggaacag cggctggcgt cagaaaaaat cagtgagctg       420
     atcctcgcga ccaacccgac ggttgaaggg gaggctaccg cgaactatat tgccgagctg       480
     tgcgcggagg ccggcgtcga agccagtcgt atcgcccacg gcgtgccggt tggcggcgaa       540
     ctggagatgg tcgacggtac gacgctgtcc cactcgctgg cgggacgcca taagattatt       600
     ttctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page