(data stored in ACNUC7421 zone)

EMBL: AE006468.RPME2

AE006468.RPME2       Location/Qualifiers
FT   CDS_pept        526355..526615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE2"
FT                   /locus_tag="STM0469"
FT                   /product="putative 50S ribosomal protein L31 (second copy)"
FT                   /note="similar to E. coli putative ribosomal protein
FT                   (AAC73399.1); Blastp hit to AAC73399.1 (87 aa), 74%
FT                   identity in aa 1 - 86"
FT                   /db_xref="EnsemblGenomes-Gn:STM0469"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19423"
FT                   /db_xref="GOA:P66193"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66193"
FT                   /protein_id="AAL19423.1"
FT                   /translation="MKPDIHPVYRTVVFHDTSANEYVKVGSTIKTEREIELDGVTYPYV
FT                   TIDVSSKSHPFYTGRQKTFDSESSAARFQKRFGHFIGAKRG"
     atgaaacctg atattcatcc tgtataccgc accgtcgtat ttcacgacac cagcgcaaat        60
     gaatatgtga aagtgggatc aactatcaaa actgaacgtg aaatcgaact ggacggcgtg       120
     acatatccgt atgtcactat tgatgtgtca tcaaaatcgc atccttttta taccggtaga       180
     cagaaaacgt ttgatagcga aagtagcgcc gcacgcttcc agaaacgttt cggtcatttt       240
     atcggcgcta aacgggggta a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page