(data stored in ACNUC7421 zone)

EMBL: AE006468.RPMJ2

AE006468.RPMJ2       Location/Qualifiers
FT   CDS_pept        526621..526761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ2"
FT                   /locus_tag="STM0470"
FT                   /product="putative 50S ribosomal protein L36 (second copy)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0470"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19424"
FT                   /db_xref="GOA:P66296"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:P66296"
FT                   /protein_id="AAL19424.1"
FT                   /translation="MQVLNSLRNAKQRHPDCQIVKRKGRLYVICKTNPRFKAVQGRKKR
FT                   R"
     atgcaggtgt taaactcact tcgcaatgca aaacaacggc atccggattg ccagatagtc        60
     aaacgcaaag gacgcttata cgtgatttgt aaaacaaatc cgcgttttaa ggcggttcag       120
     gggcgtaaaa aaagacgtta a                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page