(data stored in ACNUC7421 zone)

EMBL: AE006468.SAFA

AE006468.SAFA        Location/Qualifiers
FT   CDS_pept        342210..342722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="safA"
FT                   /locus_tag="STM0299"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19256"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR018569"
FT                   /db_xref="PDB:2CNY"
FT                   /db_xref="PDB:2CNZ"
FT                   /db_xref="PDB:2CO1"
FT                   /db_xref="PDB:2CO2"
FT                   /db_xref="PDB:2CO3"
FT                   /db_xref="PDB:2CO4"
FT                   /db_xref="PDB:2CO6"
FT                   /db_xref="PDB:2CO7"
FT                   /db_xref="PDB:3CRE"
FT                   /db_xref="PDB:3CRF"
FT                   /db_xref="PDB:5Y9H"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRK4"
FT                   /protein_id="AAL19256.1"
FT                   /translation="MVIQMKSIKKLIIASALSMMAASCYAGSFLPNSEQQKSVDIVFSS
FT                   PQDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAG
FT                   KNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITL
FT                   DVVGYQP"
     gtggttattc aaatgaaaag cataaaaaaa ttgattatcg caagtgcgtt gagcatgatg        60
     gctgctagtt gttatgctgg ctcatttttg ccgaactcag agcaacaaaa atcagtggat       120
     attgtgtttt cctctcccca agatttaacc gtatcgctta ttccagtgtc gggcttaaag       180
     gctgggaaaa atgctcctag cgcgaaaatt gcgaagcttg tagttaattc tactactctt       240
     aaagaattcg gggtcagggg gatttctaac aacgtggtag acagtactgg cactgcatgg       300
     cgtgtagctg gtaaaaatac tggtaaagag atcggtgtgg gcttatcaag tgacagtctt       360
     agaagatctg atagcacgga aaaatggaat ggggtgaact ggatgacctt taatagcaat       420
     gacacacttg atattgtcct gacaggaccg gcgcagaatg tcacagctga cacgtaccca       480
     ataactttag acgtagtggg atatcaacct taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page