(data stored in ACNUC7421 zone)

EMBL: AE006468.SECD

AE006468.SECD        Location/Qualifiers
FT   CDS_pept        462332..464179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="STM0407"
FT                   /product="preprotein translocase, IISP family, part of the
FT                   channel"
FT                   /note="similar to E. coli protein secretion; membrane
FT                   protein, part of the channel (AAC73511.1); Blastp hit to
FT                   AAC73511.1 (615 aa), 94% identity in aa 1 - 615"
FT                   /db_xref="EnsemblGenomes-Gn:STM0407"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19361"
FT                   /db_xref="GOA:Q8ZRD7"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRD7"
FT                   /protein_id="AAL19361.1"
FT                   /translation="MLNRYPLWKYIMLVVVIIVGLLYALPNLYGEDPAVQITGVRGVAA
FT                   SEQTLIQVQKTLQEEKIPAKSVALEEGAILARFDTTDTQLRAREALMSVLGDKYVVALN
FT                   LAPATPRWLAAIHADPMKLGLDLRGGVHFLMEVDIDTALGKLQEQNIDSLRSDLREKGI
FT                   PYTTVRKENNYGLSITFRDSKARDEAIAYLTPRHRDLVISSQSGNQLRAVMTDARLSEA
FT                   REYAVQQNINILRNRVNQLGVAEPVVQRQGADRIVVELPGIQDTARAKEILGATATLEF
FT                   RLVNTNVDQAAAAAGRVPGDSEVKQTREGQPVVLYKRVILTGDHITDSTSSQDEYNQPQ
FT                   VNISLDSAGGNIMSNFTKDNIGKPMATLFVEYKDSGKKDANGRAVLVKQEEVINIANIQ
FT                   SRLGNSFRITGISNPNEARQLSLLLRAGALIAPIQIVEERTIGPTLGMQNIKQGLEACL
FT                   AGLVVSILFMIFFYKKFGLIATSALVANLVLIVGIMSLLPGATLSMPGIAGIVLTLAVA
FT                   VDANVLINERIKEELSNGRTVQQAINEGYAGAFSSIFDANITTLIKVIILYAVGTGAIK
FT                   GFAITTGIGVATSMFTAIIGTRAIVNLLYGGKRVTKLSI"
     gtgttaaacc gttatccttt gtggaagtac atcatgctgg tcgtcgtgat tatcgtcggc        60
     ctgctttacg cacttcccaa cctgtatggt gaggatccgg ctgttcaaat cactggcgtg       120
     cgcggcgtcg ccgccagtga gcaaacgctg atccaggtcc agaaaacgtt acaagaagaa       180
     aaaattcccg ctaagtctgt ggcactggaa gagggcgcta ttcttgcgcg cttcgacacc       240
     accgataccc agctacgcgc ccgtgaagcg ctgatgagcg tgctggggga taaatatgtc       300
     gtggcgctta accttgcgcc ggctacgccg cgctggttgg cggctattca cgccgatccg       360
     atgaagctcg gtcttgatct gcgcggcggc gttcacttcc tgatggaagt ggatatagat       420
     accgcgttag gtaaactcca ggaacaaaat atcgatagcc tgcgcagcga tctgcgtgaa       480
     aaaggcattc cttataccac cgttcgtaaa gaaaataatt atgggttgag catcacgttc       540
     cgtgacagca aagcgcgtga tgaggcgatc gcctatctga cgccgcgtca tcgtgacctg       600
     gtgatttcca gccagagcgg taatcaactt cgcgcggtaa tgaccgatgc gcgcctgagc       660
     gaagcgcgtg aatacgccgt tcagcagaac attaatattc tgcgtaaccg tgttaaccaa       720
     ctgggcgtcg cggagcctgt cgtacaacgc cagggcgcag accgtattgt ggttgagctg       780
     ccgggtatcc aggataccgc tcgcgcgaaa gaaattctcg gcgcgaccgc gacgctggaa       840
     ttccgtctgg tgaataccaa cgttgaccag gccgccgctg ctgccgggcg cgtaccgggt       900
     gattccgaag tgaaacagac ccgcgaaggt cagccggtgg tattgtacaa acgcgtgatc       960
     ctcaccggcg accatatcac cgactcgacg tccagccagg atgaatataa ccaaccgcag      1020
     gttaacatct cgctggatag cgcaggcggc aatatcatgt ctaacttcac taaggacaat      1080
     atcggcaaac cgatggcgac cctgtttgtg gagtataaag acagcggtaa gaaagacgct      1140
     aacggtcgcg ccgtactggt gaaacaggaa gaagtgatta acattgccaa catccagtcc      1200
     cggctgggta acagcttccg tattaccggt atcagcaacc cgaacgaagc gcgtcagctc      1260
     tcgttgttgc tgcgtgcggg cgccctgatt gcgccgattc agatcgttga agagcgcacc      1320
     attggcccga ctctgggtat gcagaacatc aagcagggcc tggaagcctg tctggccggt      1380
     ctggtggtct ccatcctgtt catgatcttc ttctataaga agtttggtct gattgcgacc      1440
     agcgcgttag tggctaacct agtgttgatt gtcggtatca tgtcgctgtt gccgggggca      1500
     acgctcagta tgccggggat tgcgggtatc gtgttaaccc ttgcggtggc ggtcgacgcc      1560
     aacgttctga ttaacgaacg tatcaaagaa gagttgagta atggccgcac ggtacagcag      1620
     gcgataaacg aaggctatgc cggcgcgttc agttccatct tcgatgcgaa catcacgacg      1680
     ctgattaaag tcatcattct gtatgctgtc ggtaccgggg caattaaagg gttcgcgatt      1740
     acgaccggta tcggtgtggc gacgtcgatg tttaccgcga ttatcggtac gcgtgctatc      1800
     gtaaacctgc tatatggcgg caagcgcgtc actaagctgt caatctga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page