(data stored in ACNUC7421 zone)

EMBL: AE006468.STBA

AE006468.STBA        Location/Qualifiers
FT   CDS_pept        complement(384404..384940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbA"
FT                   /locus_tag="STM0340"
FT                   /product="putative fimbriae; major subunit"
FT                   /note="similar to E. coli major type 1 subunit fimbrin
FT                   (pilin) (AAC77270.1); Blastp hit to AAC77270.1 (182 aa),
FT                   28% identity in aa 1 - 182"
FT                   /db_xref="EnsemblGenomes-Gn:STM0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19294"
FT                   /db_xref="GOA:Q8ZRH9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRH9"
FT                   /protein_id="AAL19294.1"
FT                   /translation="MSMKKYLAMITGSLLVSSSAMAVSDNTITFQGEVSDETCSVVING
FT                   NQAKPVVLLPTVSTKDLSEQGKTAGPITFDIGLSGCTGSQDKTTKISTVFVGNQVTSNG
FT                   NLGNTGSAKNVEVQLLDTSGEPINLTGGFTGDGDLQLEPNASEASATYTARYYSTGKAE
FT                   AGTVAATLQYAVSYK"
     atgtctatga aaaaatattt agcaatgatc acaggctcac ttcttgtctc cagcagcgcg        60
     atggctgttt ctgataacac catcaccttt caaggggaag tctctgatga aacatgctct       120
     gtcgttatta atggtaatca ggctaaaccc gtcgtgttat taccaacagt aagtactaaa       180
     gatttatcag aacaagggaa aaccgcgggg ccaataacgt ttgatattgg gctgtccggg       240
     tgtaccggct ctcaggacaa aacaacaaaa atttccactg tctttgtcgg taatcaggtc       300
     accagtaacg gtaacctggg taatactggc agcgcgaaaa atgttgaagt ccaattactc       360
     gacacttcag gggagccaat caatctgacc ggcggcttta ctggcgacgg cgacctacag       420
     ctggaaccaa atgcttctga agcgagcgcg acttataccg cgcggtatta ctctaccggg       480
     aaagcagagg ctgggacagt cgctgccacc cttcaatacg ccgtttcgta taaataa          537
//

If you have problems or comments...

PBIL Back to PBIL home page