(data stored in ACNUC7421 zone)

EMBL: AE006468.STBC

AE006468.STBC        Location/Qualifiers
FT   CDS_pept        complement(381036..383597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbC"
FT                   /locus_tag="STM0338"
FT                   /product="putative fimbriae; usher"
FT                   /note="similar to E. coli outer membrane protein; export
FT                   and assembly of type 1 fimbriae, interrupted (AAC77273.1);
FT                   Blastp hit to AAC77273.1 (878 aa), 30% identity in aa 30 -
FT                   870"
FT                   /db_xref="EnsemblGenomes-Gn:STM0338"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19292"
FT                   /db_xref="GOA:Q8ZRI1"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRI1"
FT                   /protein_id="AAL19292.1"
FT                   /translation="MSPTINLNRKSLALLIAIVCSGSAQGEEYYFDPALLQGATYGQNI
FT                   ARFNERQTPSGDYLADVYVNGTLVTSSTNIRFNAVKEGQQTEPCLPLSVMKAAQIKSLP
FT                   ATDAATECRPLREWVPHAGWQFDSATLRLLLTIPMTELTHKPRGYISPSEWDSGALALF
FT                   LRHNTNWTHTENTDSHYRYQYLWSGLNMGVNLGLWQVRHQSNLRYANSNQSGSAWRYNS
FT                   VRTWVQRPVASVNSILSLGDSYTDSSLFGSLSFNGAKLVTDERMRPQGKRGYAPEVRGV
FT                   AASSAHVVVKQLGKVIYETNVPPGPFYIDDLYNTRYQGDLEVEVIEASGKTSRFTVPYS
FT                   SVPDSVRPGNWHYSLAFGRVRQYYDIENRFFEGTFQHGVNNTITLNLGSRIAQRYQAWL
FT                   AGGVWATGMGAFGLNATWSNARAEHNDRQQGWRAELSYSKTFTTGTNLVLAAYRYSTNG
FT                   FRDLQDVLGVRREAKTGIDYYSDTLHQRNRLSATVSQPLGRLGTLNLSASTADYYNNQS
FT                   RITQLQMGYSNQWRNISYGVNIARQRTTWDYDRFYHGVNEPLDVSSRQKYTETTMSFNV
FT                   SIPLDWGENRTSVAMNYNQSSQSRSSTVSMTGSSGENSDLSWSVYGGYERYRNSNSDSS
FT                   APTTFGGNLQQNTRFGALRANYDQGDNYRQEGLGASGTLVLHPGGLTAGPYTSDTFALI
FT                   HADGAQGAIVQNGQGAVVDRFGYAILPSLSPYRVNNVTLDTRKMRSDAELTGGSQQIVP
FT                   YAGAIARVNFATISGKAVLISVKMPDGGIPPMGADVFNGEGTNIGMVGQSGQIYARIAH
FT                   PSGSLLVRWGTGANQRCRVAYQLDLHTKEPFLYLNKICEKE"
     atgtccccca ccattaattt gaaccgcaaa agccttgcgc tattgatcgc catagtttgc        60
     tcaggctccg cgcaaggtga agagtattat tttgatcctg cgctacttca gggggccact       120
     tacggacaaa atattgcccg ttttaatgaa cggcaaacgc cttccggaga ctatcttgcc       180
     gacgtttacg ttaatggcac gctggtaacc tcgagcacta atattcgatt taatgctgta       240
     aaagagggtc aacagactga accctgcctg cccttatcgg tgatgaaagc ggcacagata       300
     aaatcactcc ccgcgaccga cgctgcgacc gagtgtcgcc cgctcaggga gtgggtgcct       360
     catgccggtt ggcaatttga tagcgccacg cttcgcctgt tgctgacgat tccaatgacc       420
     gaacttacgc acaaaccgcg cggttatatc tctccttcag agtgggatag cggcgcgctg       480
     gcgctgtttt tacgccataa cacaaactgg acccacaccg aaaataccga cagccattat       540
     cgctaccaat acttatggag cggtttaaac atgggcgtta acctcggact ttggcaggtc       600
     cgtcatcaaa gtaatctgcg ctatgccaat agcaaccaga gcggaagcgc ctggcgctat       660
     aatagcgttc gaacctgggt gcaaagacct gtcgcgtctg ttaacagtat tctgtcgctg       720
     ggcgatagct atacggactc cagcttattc ggcagtctgt cttttaacgg ggctaaactt       780
     gtcaccgacg agcggatgcg cccgcagggc aaacgcggtt atgcgccgga agttcggggc       840
     gtagcggcca gtagcgcgca cgtggtagta aaacaactgg ggaaagtgat ttatgaaacc       900
     aacgttccgc cgggcccatt ttatattgac gatctgtaca acacccgtta tcaaggcgat       960
     ctggaggtag aggttatcga ggccagcggt aaaacctcac gtttcaccgt gccttattct      1020
     tccgtgccgg attcggttcg ccccggtaac tggcactatt cgctggcctt cggcagggtt      1080
     cgtcagtact acgatattga aaatcgtttc tttgagggaa cgttccagca cggcgttaat      1140
     aacaccatta ccctcaacct cggttcacga attgcgcagc gttaccaggc atggctggcg      1200
     ggcggcgtct gggccaccgg tatgggcgcg ttcggcctta acgccacctg gtcgaatgcg      1260
     cgcgcagagc ataacgatcg ccaacaaggc tggcgcgcgg aactcagtta cagcaaaacg      1320
     tttaccaccg gcactaacct ggtactggcg gcttatcgtt attcaaccaa cggctttcgc      1380
     gatcttcagg acgtgctcgg cgtacgccgg gaagcaaaaa cggggattga ttactactcc      1440
     gacacgctgc atcagcgcaa tcgcctgtcc gcgacggtaa gccagccgtt aggacggctt      1500
     ggcacgctta acctcagcgc cagcaccgca gactactaca ataaccaatc gcgtataaca      1560
     cagctacaaa tgggatatag caaccagtgg cggaatataa gctacggggt gaatatcgca      1620
     cgacagcgca ccacctggga ttacgatcgc ttttatcacg gcgttaacga accactggac      1680
     gtgagtagcc gacaaaaata taccgaaacc acaatgtcgt ttaatgtctc tataccgctg      1740
     gattggggcg aaaacagaac gtctgtcgcc atgaattata accagtccag tcaaagtcgt      1800
     tcctcaaccg tatccatgac cggcagtagc ggtgaaaaca gcgacctgtc atggtcggtt      1860
     tatggcggct acgagcgtta tcgcaatagc aatagtgata gcagcgcgcc aacgacgttt      1920
     ggcggtaatc tacaacaaaa cacccggttt ggcgcacttc gcgccaacta tgaccagggt      1980
     gataactatc gtcaggaagg gctgggcgcg tccggcaccc tggttcttca ccctggcggt      2040
     ctgacggctg gcccctatac cagcgatacc tttgcgctta ttcatgccga tggcgcgcag      2100
     ggcgcgatcg tacaaaatgg ccagggcgct gtggttgatc gctttggtta cgccattctg      2160
     ccttcgttat ctccttaccg cgtcaataac gttacgctcg atacccgtaa gatgcgcagc      2220
     gatgccgaac tgacgggagg aagtcagcag attgtgccgt atgctggcgc catcgcgcgt      2280
     gtcaatttcg ccactatcag cggcaaagca gtgctgatct ccgtgaagat gccggatggc      2340
     ggcataccgc caatgggcgc tgatgttttc aacggtgaag gcacaaacat cggcatggtc      2400
     ggccagagtg ggcagattta tgcccgtatc gcccatccgt cgggttctct actggtgcgc      2460
     tggggaacag gggcaaacca gcgttgccgg gttgcctacc aactcgatct tcacaccaaa      2520
     gaaccgtttc tctatctgaa caaaatctgc gagaaggaat ag                         2562
//

If you have problems or comments...

PBIL Back to PBIL home page