(data stored in ACNUC7421 zone)

EMBL: AE006468.STFG

AE006468.STFG        Location/Qualifiers
FT   CDS_pept        235735..236265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stfG"
FT                   /locus_tag="STM0200"
FT                   /product="putative minor fimbrial subunit"
FT                   /note="putative adhesin; minor fimbrial subunit StfG
FT                   (gi|3747034)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19164"
FT                   /db_xref="GOA:Q8ZRP9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRP9"
FT                   /protein_id="AAL19164.1"
FT                   /translation="MAKRQALLHGAACILCGALILPVSAADNLHFSGSLVASPCTLTMQ
FT                   GTGIAEVDFSSLDSSDFTPDGQSARKPLVFELTDCDSALSNGVQVTFTGTEATGMRGIL
FT                   AIDSYSGASGIGIGIETLSGVPVGMNDKEGAIFTLVTGKNTLNLNAWVQRLPGEDLIPG
FT                   RFSASALATFEYL"
     atggctaaaa gacaggcgtt attacacggc gcggcctgca tcctctgtgg ggcgctgata        60
     ttgccggtct cagcggcaga taacctgcat ttttccggta gcctggtggc cagtccttgc       120
     acgctcacga tgcaggggac ggggattgcc gaagtcgatt tttcgtcgct tgacagttct       180
     gatttcactc ccgacggcca gtctgctcgt aagcctttgg tgtttgaact cacggattgc       240
     gattcggcgc tgagtaacgg ggtgcaggtg actttcactg gaaccgaagc gaccggaatg       300
     cgcggtatcc tggccatcga tagctattca ggcgcttccg ggatcgggat tggtattgaa       360
     acgctatccg gcgttcccgt gggcatgaac gataaagagg gtgcgatatt tacgctggtg       420
     acggggaaaa atacgctaaa cctgaatgcc tgggtacaac gtcttcccgg cgaggacctg       480
     attccgggaa ggttctctgc aagtgcgcta gccacatttg agtatttata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page