(data stored in ACNUC7421 zone)

EMBL: AE006468.THRB

AE006468.THRB        Location/Qualifiers
FT   CDS_pept        2801..3730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="STM0003"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="similar to E. coli homoserine kinase (AAC73114.1);
FT                   Blastp hit to AAC73114.1 (310 aa), 93% identity in aa 1 -
FT                   308"
FT                   /db_xref="EnsemblGenomes-Gn:STM0003"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18967"
FT                   /db_xref="GOA:P65226"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:P65226"
FT                   /protein_id="AAL18967.1"
FT                   /translation="MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFR
FT                   LHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVV
FT                   AALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQ
FT                   QVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLA
FT                   AALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVAD
FT                   WLSKHYLQNQEGFVHICRLDTAGARVVG"
     atggtgaaag tgtatgcccc ggcttccagc gcgaacatga gcgtcggttt cgacgtgttg        60
     ggcgcagccg tcacacccgt tgacggcacg ttgctgggcg atgtggtatc cgttgaagca       120
     gcggaccatt tccgtctgca taacctgggg cgatttgccg ataaactgcc gccggagccg       180
     cgtgaaaata ttgtttatca gtgctgggaa cgtttttgcc aggcattggg gaaaaccatc       240
     ccggtggcga tgacgctgga aaaaaatatg ccgattggtt ccgggttagg gtccagcgcc       300
     tgttccgtcg tcgccgcgct ggtcgcgatg aatgagcact gcggcaaacc gttaaacgac       360
     acgcgtctgt tggcgctgat gggcgagctg gaaggccgta tctccggcag catccattac       420
     gataacgtcg cgccgtgctt tcttggcggt atgcagttga tgattgaaga aaacggcatt       480
     attagtcagc aggtgccggg ctttgatgag tggctatggg tactggctta tccgggcatt       540
     aaagtttcta ccgcagaagc acgggccatt ttgcctgcgc agtatcgccg tcaggattgc       600
     attgcgcatg gacggcatct ggccggtttt attcacgcct gttactcgcg gcagccgcag       660
     cttgccgccg cgctgatgaa agatgttatt gccgaaccat accgcgcgcg tttactgccg       720
     ggctttagcc aggcgcggca ggcggtgtcg gagatcggcg cgctggcgag cgggatttcc       780
     gggtcggggc cgacgctgtt tgcgctatgc gataaaccgg agacggcgca gcgcgtcgcg       840
     gactggctga gcaaacatta tctgcaaaat caggaaggct tcgttcatat ttgccggctg       900
     gatacggcgg gcgcacgagt agtgggataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page