(data stored in ACNUC7421 zone)

EMBL: AE006468.TSF

AE006468.TSF         Location/Qualifiers
FT   CDS_pept        255281..256132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="STM0217"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /note="similar to E. coli protein chain elongation factor
FT                   EF-Ts (AAC73281.1); Blastp hit to AAC73281.1 (283 aa), 96%
FT                   identity in aa 1 - 283"
FT                   /db_xref="EnsemblGenomes-Gn:STM0217"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19181"
FT                   /db_xref="GOA:P64052"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:P64052"
FT                   /protein_id="AAL19181.1"
FT                   /translation="MAEITASLVKELRERTGAGMMDCKKALTEANGDIELAIENMRKSG
FT                   AIKAAKKAGNVAADGVIKTKIDGNVAFILEVNCQTDFVAKDAGFQAFADKVLDAAVAGK
FT                   ITDVEVLKAQFEEERVALVAKIGENINIRRVASLEGDVLGSYQHGARIGVLVAAKGADE
FT                   ELVKQLAMHVAASKPEFVKPEDVSADVVEKEYQVQLDIAMQSGKPKEIAEKMVEGRMKK
FT                   FTGEVSLTGQPFVMEPSKSVGQLLKEHNADVTGFIRFEVGEGIEKVETDFAAEVAAMSK
FT                   QS"
     atggctgaaa ttaccgcatc cctggtaaaa gagctgcgtg agcgtaccgg cgcaggcatg        60
     atggattgca aaaaagcgct gactgaagcg aatggcgaca ttgagctggc aatcgaaaac       120
     atgcgtaagt ccggcgctat caaagcggcg aaaaaagcag gcaacgtggc tgctgacggc       180
     gtaatcaaaa ccaaaatcga cggcaacgtc gctttcattc tggaagttaa ctgccagact       240
     gacttcgtgg ctaaagatgc tggcttccag gcatttgctg acaaagtgct ggacgccgct       300
     gttgctggca aaatcactga cgtagaagtt ctgaaagcac agttcgaaga agagcgcgtt       360
     gctctggtag cgaaaattgg cgagaacatc aacattcgtc gcgtcgcttc cctggaaggc       420
     gacgttctgg gttcttacca gcacggtgcg cgcatcggcg ttctggttgc cgctaaaggc       480
     gctgacgaag agctggttaa acagctggcg atgcacgttg cggcaagcaa gccggaattc       540
     gttaagccgg aagacgtgtc tgctgacgtg gtagagaaag agtaccaggt acagctggac       600
     atcgcgatgc agtccggtaa gccgaaagaa atcgcagaga aaatggttga aggccgcatg       660
     aagaaattca ccggcgaagt ttctctgact ggtcagcctt tcgtcatgga accgagcaaa       720
     tctgttggcc aactgctgaa agagcacaac gctgacgtga ctggcttcat ccgctttgaa       780
     gtgggcgaag gcattgagaa agtcgagact gactttgcag cagaagttgc tgcgatgtct       840
     aagcagtcct ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page