(data stored in ACNUC7421 zone)

EMBL: AE006468.TSX

AE006468.TSX         Location/Qualifiers
FT   CDS_pept        complement(467538..468401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsx"
FT                   /locus_tag="STM0413"
FT                   /product="nucleoside channel; receptor of phage T6 and
FT                   colicin K"
FT                   /note="nucleoside-specific channel-forming protein TSX
FT                   precursor. (SW:TSX_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0413"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19367"
FT                   /db_xref="GOA:P0A261"
FT                   /db_xref="InterPro:IPR003055"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A261"
FT                   /protein_id="AAL19367.1"
FT                   /translation="MKKTLLAVSAALALTSSFTANAAENDQPQYLSDWWHQSVNVVGSY
FT                   HTRFSPKLNNDVYLEYEAFAKKDWFDFYGYIDIPKTFDWGNGNDKGIWSDGSPLFMEIE
FT                   PRFSIDKLTGADLSFGPFKEWYFANNYIYDMGDNKASRQSTWYMGLGTDIDTGLPMGLS
FT                   LNVYAKYQWQNYGASNENEWDGYRFKVKYFVPITDLWGGKLSYIGFTNFDWGSDLGDDP
FT                   NRTSNSIASSHILALNYDHWHYSVVARYFHNGGQWQNGAKLNWGDGDFSAKSTGWGGYL
FT                   VVGYNF"
     atgaaaaaaa ctttactcgc agtcagcgca gcgctggcgc tcacctcatc ttttactgct        60
     aacgcagcag aaaatgatca gccgcagtat ttgtccgact ggtggcacca gagcgtaaac       120
     gtggtaggca gctaccatac ccgtttctcg ccgaaattga acaacgacgt ctatctggaa       180
     tatgaagcat ttgccaaaaa agactggttt gatttctacg gctatatcga tattcccaaa       240
     acctttgatt ggggtaacgg caacgataaa ggtatctggt ccgacggttc tccgctgttc       300
     atggaaatcg aaccgcgttt ctcaattgat aagctgaccg gcgcagacct gagcttcggc       360
     ccgtttaaag agtggtattt cgccaacaac tacatctacg atatgggcga taacaaagcc       420
     agccgccaga gcacgtggta tatgggtctg gggaccgata tcgacaccgg cctgccgatg       480
     ggtctgtcgc tgaacgtgta tgcgaaatat cagtggcaaa actacggcgc gtccaatgaa       540
     aacgaatggg acggctaccg tttcaaagtg aaatacttcg tccccatcac cgatctgtgg       600
     ggcggtaaac tgagctatat cggctttacc aactttgact ggggatctga tttaggcgac       660
     gatccgaacc gtaccagcaa ctccatcgct tccagccata tcctggcgct gaactacgat       720
     cactggcact actcggtcgt tgcgcgttac ttccataacg gcggacagtg gcagaatggc       780
     gcaaaactga actggggcga cggcgatttc agcgcgaaat ctaccggctg gggcggctac       840
     ctggtcgtgg gttacaactt ctaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page