(data stored in ACNUC7421 zone)

EMBL: AE006468.YAAJ

AE006468.YAAJ        Location/Qualifiers
FT   CDS_pept        complement(5966..7396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="STM0006"
FT                   /product="putative alanine/glycine transport protein"
FT                   /note="AGCS family; similar to E. coli inner membrane
FT                   transport protein (AAC73118.1); Blastp hit to AAC73118.1
FT                   (476 aa), 76% identity in aa 1 - 476"
FT                   /db_xref="EnsemblGenomes-Gn:STM0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAL18970"
FT                   /db_xref="GOA:Q8ZS16"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZS16"
FT                   /protein_id="AAL18970.1"
FT                   /translation="MPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQFRYIRQFSR
FT                   SLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWMWVSAIIGMA
FT                   TSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAYGLIFNSVQA
FT                   NAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPLIALLWVAGSVFI
FT                   CLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNEAGMGSTPNA
FT                   AAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTEGIQLLQHAM
FT                   VSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLRLATLGMVIA
FT                   GTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLASDYLRQRKLGVRPQFDPRRF
FT                   PDIEPQLAPDTWEAASRD"
     atgcctgagt ttttcagttt tattaacgaa atactctggg gctcggtaat gatttacctg        60
     ctgctcggcg caggatgttg gtttacctgg cgtaccggat tcattcagtt tcgttatatt       120
     cgccaattta gccgcagtct gaaaggcagc cttagcccgc agccaggcgg cctgacgtca       180
     tttcaggctc tgtgtaccag cctcgcggcg cggattggca gcggtaacct ggccggcgtg       240
     gcgctggcta tcgccgcagg cggtcccggc gcggtattct ggatgtgggt ctcggccatc       300
     attggcatgg cgacctcctt cgccgagtgt tcgcttgccc agctttataa agaacgtgac       360
     ccgacaggcc agttccgcgg cggcccggcg tggtatatgg cgcgtgggct gggaatgcgc       420
     tggatgggcg tggttttcgc cctctttctg ctcgtcgcct acgggttgat ttttaatagc       480
     gtgcaggcga atgccgtctc acgcgcgctc catttcgcct tcaacattcc gccgcttatc       540
     tccggcattg ctctggcgtt ctgtgccctg ttaattatca ttcgcggcat caaaggcgtc       600
     gcccgtctga tgcaatggct gattcccctc atcgcgttat tgtgggtcgc cggcagcgta       660
     ttcatttgcc tctggcatat tgagcaaatg cctggcgtta tcgcctcgat agtcaaaagc       720
     gcatttggct ggcaggaagc cgcggcaggc gcagccggat atacgctcac ccaggctatt       780
     accagcggtt ttcagcgtgg gatgttctct aatgaagcgg gaatggggtc aacgcctaat       840
     gcggccgcag cggcaacgtc gtatccccct caccctgtcg cgcaggggat tgtgcaaatg       900
     attggcgtat tcagcgacac cattatcatc tgtaccgcca gcgcgatgat tatcctgctg       960
     gcggggaatc acgcgtccca ctcgtcaaca gaaggcattc agcttctcca acatgcaatg      1020
     gtttcgttga ccggtgaatg gggcgccagt tttgtcgcgc ttatcgtcat tctgttcgcg      1080
     ttcagttcta tcgtcgccaa ctatatttac gccgaaaaca atctgttttt tctgcggtta      1140
     cataacgcaa aggctatctg gctattacgc cttgcgacgc ttggcatggt tatcgccggt      1200
     acgcttatca gttttccgct gatatggcag ctcgctgaca tgatcatggc ctgtatggcc      1260
     attaccaatc tgacggcgat tttgttgctc tcaccggtgg tgtataccct cgccagcgat      1320
     tatctgcgac aacggaaact gggcgtaaga ccgcagttcg atccgcggcg cttcccggat      1380
     atcgaaccac aactggcgcc agatacctgg gaggcggcat cgcgcgatta a               1431
//

If you have problems or comments...

PBIL Back to PBIL home page