(data stored in ACNUC7421 zone)

EMBL: AE006468.YAAY

AE006468.YAAY        Location/Qualifiers
FT   CDS_pept        52649..52864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaY"
FT                   /locus_tag="STM0044"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73135.1); Blastp hit to AAC73135.1 (72 aa), 71%
FT                   identity in aa 3 - 72"
FT                   /db_xref="EnsemblGenomes-Gn:STM0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19008"
FT                   /db_xref="InterPro:IPR020105"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR94"
FT                   /protein_id="AAL19008.1"
FT                   /translation="MQHSLRSDGAGFYQLACCEYSLSMRKIALSGGFWGGVCRMAMKSI
FT                   FFMFHQGNRRLTLTAVQGILLRFSLF"
     ttgcagcact cgttgcgtag tgatggcgca ggattctacc agcttgcgtg ctgtgaatac        60
     agcctttcca tgagaaaaat tgcattaagc ggcgggtttt ggggcggagt ttgccgcatg       120
     gcgatgaaaa gcatcttctt tatgtttcat cagggcaatc gccggttaac cttaaccgct       180
     gtacaaggta tactcttgcg attttcactg ttttga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page