(data stored in ACNUC7421 zone)

EMBL: AE006468.YABB

AE006468.YABB        Location/Qualifiers
FT   CDS_pept        139947..140405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabB"
FT                   /locus_tag="STM0119"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73192.1); Blastp hit to AAC73192.1 (152 aa), 94%
FT                   identity in aa 1 - 152"
FT                   /db_xref="EnsemblGenomes-Gn:STM0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19083"
FT                   /db_xref="GOA:Q8ZRU9"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRU9"
FT                   /protein_id="AAL19083.1"
FT                   /translation="MFRGATLVNLDSKGRLTVPTRYREQLIESATGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWYQQVKEDIDAEQSATETLSERLQDLSL"
     atgttccggg gggcaacgtt agtcaatctc gacagtaaag ggcgcctgac cgtgccgacc        60
     cgttatcggg agcaactgat cgagagcgct accggtcaaa tggtatgtac cattgacatc       120
     catcacccat gcctgctgct ttaccccctg cctgaatggg aaattattga gcaaaagtta       180
     tctcgtctgt cgagcatgaa cccggtagaa cgtcgcgtac agcgtttact gttgggccat       240
     gccagcgaat gtcagatgga tggtgcaggt cgattactga tcgcgccagt tctgcggcaa       300
     catgccggac tgacgaaaga agtgatgctg gttggacagt tcaacaaatt tgagctgtgg       360
     gatgaaacga cctggtatca acaggtcaag gaagatatcg acgctgaaca gtcagctacc       420
     gaaacgttat cggagcggct gcaggacttg tctctataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page