(data stored in ACNUC7421 zone)

EMBL: AE006468.YABJ

AE006468.YABJ        Location/Qualifiers
FT   CDS_pept        complement(123410..124117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="STM0106"
FT                   /product="putative ABC-transport protein"
FT                   /note="similar to E. coli putative ATP-binding component of
FT                   a transport system (AAC73177.1); Blastp hit to AAC73177.1
FT                   (232 aa), 84% identity in aa 1 - 230"
FT                   /db_xref="EnsemblGenomes-Gn:STM0106"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19070"
FT                   /db_xref="GOA:Q8ZRV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRV2"
FT                   /protein_id="AAL19070.1"
FT                   /translation="MLKLIDITWLYHHLPMRFTLAVERGEQVAILGPSGAGKSTLLNLI
FT                   AGFLAPASGTLLIAGDDHTLTPPSRRPVSMLFQENNLFSHLNVQQNIGLGLNPGLTLNA
FT                   SQREKRDAIAHQMGIESLMTRLPGELSGGQRQRVALARCLVREQPVLLLDEPFSALDPA
FT                   LRQEMLTLVSDICRERQLTLLMVSHSVEDAARIAPRSIVVADGRIAWQGKTDELLSGQA
FT                   SASALLGIKSHIL"
     atgctaaaac tgattgatat cacctggctt taccatcatt tgccgatgcg ttttacgctg        60
     gcggtagaac gcggcgagca ggtggcgatt cttggcccca gcggcgcggg gaaaagcacg       120
     ttgttgaatt taattgccgg ttttcttgcg cctgccagcg gtacgctact gattgccggc       180
     gacgatcata cgcttacgcc gccctcacgc cgtccggtct caatgctgtt tcaggagaat       240
     aatttattca gccacctgaa tgtgcagcaa aatatcggtc tggggctaaa ccctgggtta       300
     acgctcaacg ccagccagcg ggaaaaacgg gacgctatcg cacatcagat gggcattgag       360
     agtctgatga cgcgtttacc gggcgaactg tccggcggcc agcgtcagcg ggtagcgctg       420
     gcgcgctgcc tggtacgcga acagccggta ctgctgctgg atgaaccgtt ctccgcgctc       480
     gatcccgcgc tgcgccagga gatgctgacg ttggtcagcg atatctgccg cgagcgacag       540
     ctcacgctgt tgatggtctc gcacagcgtg gaagatgcgg cgcgaattgc gccccggtca       600
     atcgtcgtgg ccgacgggcg tatcgcgtgg caaggcaaaa cagacgagct actaagcggt       660
     caagccagcg cctcagcgct attgggcatc aaatcccata ttttgtag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page