(data stored in ACNUC7421 zone)

EMBL: AE006468.YACL

AE006468.YACL        Location/Qualifiers
FT   CDS_pept        189603..189965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="STM0160"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73230.1); Blastp hit to AAC73230.1 (136 aa), 85%
FT                   identity in aa 17 - 135"
FT                   /db_xref="EnsemblGenomes-Gn:STM0160"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19124"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRS6"
FT                   /protein_id="AAL19124.1"
FT                   /translation="MDYEFLRDVTGGVKVRMSMGHEVVGHWFNEEVKDNLSLLDEVEQA
FT                   ARTVKGSERSWQRAGHEYTIWMDGEEVMIRANQLDFSGDEMEEGMSYYDEESLSLCGME
FT                   DFLRVVAAYREFVSKA"
     atggattacg aatttctgcg cgacgttacc ggaggggtaa aagtacgaat gtcgatgggc        60
     cacgaggtgg tcggtcactg gtttaatgaa gaggttaaag acaacctctc gctactggat       120
     gaagtagaac aagccgcgcg tacggtcaaa ggcagcgaac gctcctggca acgagcaggg       180
     catgaataca cgatctggat ggacggcgaa gaagtgatga ttcgcgccaa tcaactggat       240
     ttttccggcg atgagatgga agaggggatg agttattacg atgaagagag tttatccctg       300
     tgcggcatgg aggattttct gcgggtcgtc gccgcgtatc gggaattcgt cagtaaagcc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page