(data stored in ACNUC7421 zone)

EMBL: AE006468.YADI

AE006468.YADI        Location/Qualifiers
FT   CDS_pept        209293..209733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="STM0178"
FT                   /product="putative PTS enzyme"
FT                   /note="similar to E. coli putative PTS enzyme II B
FT                   component (AAC73240.1); Blastp hit to AAC73240.1 (146 aa),
FT                   76% identity in aa 1 - 146"
FT                   /db_xref="EnsemblGenomes-Gn:STM0178"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19142"
FT                   /db_xref="GOA:Q8ZRR3"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRR3"
FT                   /protein_id="AAL19142.1"
FT                   /translation="MLGWVISCHDDRAQEMLEGLEKKYGPLAQCRAVNFWRGLSVNMLS
FT                   RMMCDALHATDSGEGVIFLTDISGAAPYRVASLMSHKHSQCEVISGVSYSLMEEMITWR
FT                   ESMSSSAFRDQIVALGAPDVTSLWHQQQKNPPFVLLHDSYEF"
     atgctgggat gggtcatttc ctgtcatgac gatcgggcgc aggaaatgct cgaaggtctt        60
     gaaaagaagt atgggccgtt ggcgcagtgt cgggcggtca atttctggcg tgggttaagc       120
     gtaaatatgc tcagccgcat gatgtgtgac gccctccatg ccaccgactc cggtgaaggc       180
     gtgatatttt taaccgacat ttccggcgcg gcgccttatc gtgtagcgtc gctgatgagc       240
     cataaacatt ctcaatgtga agttatttcc ggtgtcagct attcattgat ggaggaaatg       300
     attacctggc gagagtcaat gagcagttca gcatttcgcg accagattgt cgcgcttggc       360
     gcgccggatg tcaccagtct ctggcatcag cagcagaaaa atccgccttt tgtattgctg       420
     catgattcgt atgagttttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page