(data stored in ACNUC7421 zone)

EMBL: AE006468.YADQ

AE006468.YADQ        Location/Qualifiers
FT   CDS_pept        238662..240083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadQ"
FT                   /locus_tag="STM0203"
FT                   /product="putative ClC family chlorine transport protein"
FT                   /note="similar to E. coli putative channel transporter
FT                   (AAC73266.1); Blastp hit to AAC73266.1 (473 aa), 78%
FT                   identity in aa 1 - 473"
FT                   /db_xref="EnsemblGenomes-Gn:STM0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19167"
FT                   /db_xref="GOA:Q8ZRP8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR023861"
FT                   /db_xref="PDB:1KPL"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP8"
FT                   /protein_id="AAL19167.1"
FT                   /translation="MKTDTSTFLAQQIVRLRRRDQIRRLMQRDKTPLAILFMAAVVGTL
FT                   TGLVGVAFEKAVSWVQNMRIGALVQVADHAFLLWPLAFILSALLAMVGYFLVRKFAPEA
FT                   GGSGIPEIEGALEELRPVRWWRVLPVKFIGGMGTLGAGMVLGREGPTVQIGGNLGRMVL
FT                   DVFRMRSAEARHTLLATGAAAGLSAAFNAPLAGILFIIEEMRPQFRYNLISIKAVFTGV
FT                   IMSSIVFRIFNGEAPIIEVGKLSDAPVNTLWLYLILGIIFGCVGPVFNSLVLRTQDMFQ
FT                   RFHGGEIKKWVLMGGAIGGLCGILGLIEPAAAGGGFNLIPIAAAGNFSVGLLLFIFITR
FT                   VVTTLLCFSSGAPGGIFAPMLALGTLLGTAFGMAAAVLFPQYHLEAGTFAIAGMGALMA
FT                   ASVRAPLTGIVLVLEMTDNYQLILPMIITCLGATLLAQFLGGKPLYSTILARTLAKQDA
FT                   EQAEKNQNAPADENT"
     atgaaaacag acacttccac ctttttagct cagcaaattg tgcgtttacg gcgcagagat        60
     cagattcgcc ggttaatgca gcgggataaa acgccgctgg ccatcctgtt catggcggcc       120
     gttgtcggca cgcttaccgg actggttggc gtcgcctttg aaaaggcggt ttcctgggta       180
     caaaacatgc gcattggcgc gctggttcag gtcgcggacc atgcgttttt gctttggccg       240
     ctggccttta tcctttcggc gttactggcg atggtcggct actttttggt gcgaaaattt       300
     gcgccggaag ccggcggctc gggtatcccg gaaattgaag gtgcgctgga ggagttacgt       360
     ccggtgcgct ggtggcgcgt gttgccggtg aagtttatcg gcgggatggg aacgttgggc       420
     gcaggaatgg tattagggcg cgaagggcca acggtgcaaa tcgggggcaa cctggggcgc       480
     atggtgctgg atgtttttcg tatgcgcagc gccgaagcgc ggcatacgtt gctggcgacc       540
     ggcgcggcgg cggggctctc tgcggcgttt aacgcgccgc tggcgggtat cctgtttatt       600
     attgaagaga tgcgcccgca gtttcgctac aacctgattt cgattaaagc ggtgtttacc       660
     ggcgtcatca tgtcgagcat tgtgttccgc atatttaacg gcgaagcgcc gattattgaa       720
     gtcggcaaac tgtctgatgc gccggttaac acgctgtggt tataccttat cctcggtatt       780
     atttttggct gcgtcgggcc ggtatttaat tcgctggtgc tgcgtaccca ggatatgttt       840
     cagcgctttc atggcggcga aattaaaaaa tgggtgctta tgggcggcgc gatcggcggc       900
     ctgtgcggta ttctggggtt gattgagccg gccgcggcag gcggcggatt taaccttatt       960
     cctatcgccg cggcaggtaa ttttagcgtc gggctactgc tgttcatctt tattacccgg      1020
     gttgtcacga cgctgctttg cttttcttcc ggcgcgccgg ggggcatttt cgccccgatg      1080
     ctggcgctgg gaacgctgct tggtacggcc ttcggtatgg cggcggcagt gcttttcccg      1140
     cagtatcacc tggaggccgg tacctttgcg attgccggga tgggggcgct gatggcggcg      1200
     tcggtgcgcg ccccgttgac agggattgtg ctggtgctgg agatgaccga taactatcag      1260
     ctcattttgc caatgattat cacctgtctt ggcgcgacac tattagccca gtttttgggc      1320
     gggaaaccgt tatactcaac catcctggcg cgcactctgg cgaagcagga tgcggaacag      1380
     gcggagaaaa accagaatgc gcctgcggac gagaatactt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page