(data stored in ACNUC7421 zone)

EMBL: AE006468.YADS

AE006468.YADS        Location/Qualifiers
FT   CDS_pept        complement(240610..241233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadS"
FT                   /locus_tag="STM0205"
FT                   /product="putative inner membrane protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73268.1); Blastp hit to AAC73268.1 (207 aa), 96%
FT                   identity in aa 1 - 207"
FT                   /db_xref="EnsemblGenomes-Gn:STM0205"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19169"
FT                   /db_xref="GOA:Q7CR65"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR65"
FT                   /protein_id="AAL19169.1"
FT                   /translation="MLVYWLDIVGTAVFAISGVLLAGKLRMDPFGVLVLGVVTAVGGGT
FT                   IRDMALDNGPVFWVKDPTDLVVAMVTSMLTILLVRQPRRLPKWMLPVLDAVGLAVFVGI
FT                   GVNKAFLAETGPLVAVCMGVITGVGGGIIRDVLAREIPMILRTEIYATACIIGGIVHAT
FT                   AFYTFSVPLESASMMGMVVTLFIRLAAIRWHLKLPTFALDENGR"
     atgctcgtct attggctgga tattgtaggc acggctgtat ttgctatctc tggcgtgttg        60
     ctggccggga aattacgtat ggacccgttc ggcgtcctgg tgctcggcgt cgttactgcc       120
     gtcggcggcg ggacaatccg cgatatggcg ctggataacg gcccggtatt ctgggttaaa       180
     gatcctaccg acctggtcgt cgccatggtc accagtatgc tgaccatcct actggttcgc       240
     cagccaagac gtctaccgaa atggatgttg ccggtactgg atgcggtcgg gctggcggtg       300
     tttgtcggca ttggggtgaa taaagccttc ctcgctgaaa cggggccatt agtggctgtc       360
     tgtatgggcg tgattaccgg cgtcggcggc gggattattc gcgatgttct ggcacgcgag       420
     atccccatga tcctacgcac cgaaatctat gccacggcct gtattatcgg cgggattgtt       480
     cacgccaccg cgttttatac gttttcagta ccgctggaaa gcgccagcat gatgggtatg       540
     gtggtcacgc tgttcattcg gctggcggcc attcgctggc atttgaaatt gccgacgttt       600
     gccctggatg aaaacggacg ttga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page