(data stored in ACNUC7421 zone)

EMBL: AE006468.YAEE

AE006468.YAEE        Location/Qualifiers
FT   CDS_pept        complement(286378..287031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeE"
FT                   /locus_tag="STM0246"
FT                   /product="putative ABC superfamily (membrane) transport
FT                   protein"
FT                   /note="similar to E. coli putative transport system
FT                   permease protein (AAC73309.1); Blastp hit to AAC73309.1
FT                   (217 aa), 93% identity in aa 1 - 217"
FT                   /db_xref="EnsemblGenomes-Gn:STM0246"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19209"
FT                   /db_xref="GOA:Q8ZRN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRN0"
FT                   /protein_id="AAL19209.1"
FT                   /translation="MSEAMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQ
FT                   IMENARLYRSLSAVVNIFRSIPFIILLVWMIPFTRIIVGTSIGLQAAIVPLTVGAAPFI
FT                   ARMVENALLEIPAGLIEASRAMGATPLQIVRKILLPEALPGLVNAATITLITLVGYSAM
FT                   GGAVGAGGLGQIGYQYGYIGYNATVMNTVLVLLVVLVYLIQLSGDRIVRAVTHK"
     atgtctgagg caatgatgtg gttactggtt cgtggcgtct gggaaacgct ggcgatgacc        60
     tttgtctccg gtttcttcgg tttcgtgatt ggcctgccgg ttggcgtatt gctgtatgtt       120
     acgcgcccgg ggcagattat ggagaacgcc aggctgtatc gctccctctc tgcggtggtc       180
     aatattttcc gctcgattcc ctttatcatc ctgctggtgt ggatgattcc ttttacccga       240
     ataattgtcg gcacctccat tggtttgcag gctgcaattg taccgctgac cgtcggcgcc       300
     gcgcctttta tcgcccgtat ggtggaaaat gcgttgttag agatccctgc cgggctgatt       360
     gaagcctcac gagcgatggg cgccacgccg ctgcaaattg tacgtaaaat ccttttaccg       420
     gaagcgctgc ctggtctggt gaatgcggca accattacac tgatcaccct ggtcggttac       480
     tccgcaatgg gcggcgccgt cggcgcaggc ggtctcggtc aaatcggcta tcagtacggt       540
     tatattggat acaatgctac cgtgatgaat acggtgctgg tattacttgt cgttctggtt       600
     tatttaattc agttatccgg cgatcgcatc gtcagggctg tcacgcataa gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page