(data stored in ACNUC7421 zone)

EMBL: AE006468.YAEP

AE006468.YAEP        Location/Qualifiers
FT   CDS_pept        complement(280295..280513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeP"
FT                   /locus_tag="STM0238"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:STM0238"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19202"
FT                   /db_xref="InterPro:IPR009624"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67551"
FT                   /protein_id="AAL19202.1"
FT                   /translation="MLTGGHVEKYCELVRKRYAEIASGDLGYVPDALGCVLKVLNEVAA
FT                   DSALSESVREKAAYAAANLLVSDYVNE"
     atgctgacag gagggcatgt ggaaaaatat tgtgagttag tacgcaagcg gtatgcggaa        60
     atcgccagcg gagacttagg gtatgtcccg gatgcgctgg gttgtgtatt gaaagtgctt       120
     aatgaagtgg cggcagatag cgccctttca gagtcggtca gggaaaaggc agcttatgct       180
     gccgcgaact tactggtgag cgattatgtc aatgaatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page