(data stored in ACNUC7421 zone)

EMBL: AE006468.YAEQ

AE006468.YAEQ        Location/Qualifiers
FT   CDS_pept        280693..281238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeQ"
FT                   /locus_tag="STM0239"
FT                   /product="putative cytoplasmic protein"
FT                   /note="hypothetical 20.8 Kda protein in mesJ-cutF
FT                   intergenic region. (SW:YAEQ_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0239"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19203"
FT                   /db_xref="InterPro:IPR009822"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR038590"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A1S6"
FT                   /protein_id="AAL19203.1"
FT                   /translation="MALKATIYKAVVNVADLDRNRFLDAALTLARHPSETQERMMLRLL
FT                   AWIKYADERLQFTRGLSAEDEPEAWLRNDHLGIDLWIELGLPDERRIKKACTQASDVAL
FT                   FAYNSRAAQIWWQQHQSKCAQFANLSVWYLDDGQLAQLSEFADRTMTLQATIQDGAIWL
FT                   SDARNNLEIQLTAWQQPS"
     atggcgctta aagcgacaat ttataaagcc gtcgtcaatg tggctgacct tgatcgcaac        60
     cggtttctgg atgcggcatt gacgctggcg cgtcaccctt ctgaaacgca ggagcgcatg       120
     atgctgcgcc tgttggcatg gataaaatat gctgatgaac ggttgcagtt tacacgtggg       180
     ctcagcgcgg aagatgagcc ggaggcctgg ctgcgcaacg atcatctggg catcgatctc       240
     tggatagagc tggggctgcc ggatgagcgc cgtattaaga aagcctgtac tcaggcgagc       300
     gatgtcgcgc tctttgctta taactcccgg gcggcgcaaa tctggtggca gcagcatcaa       360
     agcaagtgcg cgcagttcgc taacctgtcc gtctggtatc tggatgacgg gcagctggcg       420
     cagctcagtg aatttgccga tcgtaccatg acgctacagg cgacgattca ggacggcgca       480
     atctggcttt ctgatgctcg gaataatctg gaaatacagc taaccgcctg gcaacagccc       540
     tcatga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page