(data stored in ACNUC7421 zone)

EMBL: AE006468.YAET

AE006468.YAET        Location/Qualifiers
FT   CDS_pept        262380..264794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeT"
FT                   /locus_tag="STM0224"
FT                   /product="putative outer membrane antigen"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73288.1); Blastp hit to AAC73288.1 (810 aa), 92%
FT                   identity in aa 1 - 810"
FT                   /db_xref="EnsemblGenomes-Gn:STM0224"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19188"
FT                   /db_xref="GOA:Q8ZRP0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="PDB:5OR1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8ZRP0"
FT                   /protein_id="AAL19188.1"
FT                   /translation="MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLS
FT                   MPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGNTLLVQVKERPTIASITFSGNKS
FT                   VKDDMLKQNLEASGVRVGESLDRTTLSDIEKGLEDFYYSVGKYSASVKAVVTPLPRNRV
FT                   DLKLVFQEGVSAKIQQINIVGNHAFSTEELISHFQLRDEVPWWNVVGDRKYQKQKLAGD
FT                   LETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYITVNITEGDQYKLSGVQVSGNLAGHS
FT                   AEIENLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSQPEINDADKTVKLRVN
FT                   VDAGNRFYVRKIRFEGNDTSKDSVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVD
FT                   TDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYSVGI
FT                   NGTKNDYQTYSELSVTNPYFTVDGVSLGGRIFYNDFQADDADLSDYTNKSYGTDVTLGF
FT                   PINEYNTLRAGLGYVHNKLSNMQPQIAMDRYLESMGQSADTSSFAADDFTFNYGWTYNK
FT                   LDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVSLDTATYVPIDNDHKWVVLGRTRWGYGD
FT                   GLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYKNGAHTSWDDNDDYEDCTQESGCK
FT                   SDDAVGGNAMAVASLEFITPTPFISEKYANSVRTSFFWDMGTVWDTNWDPSSAPSDVPD
FT                   YSDPGNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW"
     atggcgatga aaaagttgct catagcgtcg ctgctgttca gcagcgccac cgtatacggt        60
     gctgaagggt tcgtagtgaa ggacattcat ttcgaaggcc tgcagcgagt cgccgttggt       120
     gcggctctcc tcagtatgcc ggtgcgcaca ggcgacacgg ttaatgatga agatatcagt       180
     aacaccattc gcgctctgtt cgccaccggc aactttgagg acgtccgcgt cctgcgcgat       240
     ggtaataccc ttctggttca ggtaaaagaa cgtccgacca ttgccagcat cactttctcc       300
     gggaacaagt cggtgaaaga tgacatgctc aagcaaaacc tcgaagcgtc tggcgtacgt       360
     gttggcgagt ctctggatcg caccacgttg tctgatatcg aaaaaggtct ggaagacttt       420
     tactatagcg taggtaaata cagcgccagc gttaaggcgg tcgtcacgcc gctaccgcgc       480
     aaccgtgttg atcttaaact ggtgttccag gagggcgtat cggcgaagat ccaacagatc       540
     aacatcgtcg gtaaccatgc ctttagcacc gaagaactca tttctcattt ccagttgcgt       600
     gacgaagtgc cgtggtggaa cgtcgtcggc gatcgtaaat accagaaaca gaagctggcg       660
     ggcgaccttg aaaccttgcg cagctactat ctggatcgcg gctacgcgcg tttcaatatt       720
     gactccacgc aagtgagtct gacgccggat aagaaaggga tctacatcac cgtcaatatc       780
     accgaaggcg atcagtacaa gctttccggg gttcaggtga gcggtaacct ggccggacat       840
     tccgctgaaa ttgagaacct gacgaaaatt gaaccgggcg agctctataa cggcaccaaa       900
     gtgaccaaaa tggaagatga catcaaaaag cttctgggtc gctatggtta cgcctatccg       960
     cgcgtgcagt cacagcctga aattaacgat gctgacaaaa ccgtaaaact gcgcgtaaac      1020
     gtcgatgcgg gcaaccgttt ctacgtgcgt aagatccgct ttgaaggcaa cgacacctca      1080
     aaagattccg ttctgcgccg tgaaatgcgc cagatggaag gggcgtggct gggcagcgac      1140
     ctggttgacc aggggaaaga gcgtctgaac cgtctcggct tctttgaaac cgtcgacacc      1200
     gacacgcagc gcgttccggg tagcccggat caggttgatg tggtgtacaa ggtgaaagag      1260
     cgcaacaccg gtagctttaa cttcggtatc ggttacggta cagaaagcgg cgttagcttc      1320
     caggccggcg ttcagcagga caactggtta ggtaccggtt attccgtggg gattaacggc      1380
     accaaaaacg actaccagac ctacagcgaa ctgtccgtta ctaacccata ctttaccgtt      1440
     gacggcgtga gcctcggtgg tcgtatcttc tataacgact tccaggcgga cgacgcggat      1500
     ctatccgact ataccaacaa gagttacggt acggatgtga cgcttggctt ccccatcaac      1560
     gagtacaaca cgttgcgtgc tggtctgggt tatgtccata acaaactgtc caacatgcag      1620
     ccgcagatcg cgatggatcg ttatcttgag tcgatgggac aatctgctga taccagcagt      1680
     tttgccgctg atgacttcac ctttaactac ggctggacct ataacaagct tgaccgtggt      1740
     tatttcccga cggacggttc gcgcgtcaat ctgacgggga aagtgacgat tccaggttcc      1800
     gacaacgaat actacaaagt gtcgctggat accgcgacct atgtgcctat cgataacgat      1860
     cacaagtggg tggttctggg gcgtactcgc tggggttacg gcgatggttt aggcggcaag      1920
     gaaatgccgt tctatgagaa cttctatgcc ggtggttcca gtaccgtgcg tggtttccag      1980
     tcgaatacta tcggcccgaa agcggtctat aaaaatggcg cccatactag ttgggacgat      2040
     aatgatgatt acgaagactg tactcaggaa tcaggctgta aatcagatga tgcggtaggt      2100
     ggtaatgcca tggctgtcgc cagcctggaa tttattaccc cgacgccgtt catcagcgaa      2160
     aagtatgcca actcggttcg tacctccttc ttctgggata tgggtaccgt ttgggatacg      2220
     aactgggatc cgtcatctgc gccgtcagat gtaccggatt acagcgatcc aggcaacatc      2280
     cgtatgtccg cgggtatcgc attacaatgg atgtccccat tggggccgtt ggtcttctcc      2340
     tacgcccagc cgtttaaaaa gtacgatgga gacaaagccg agcagttcca gtttaacatt      2400
     ggtaaaacct ggtaa                                                       2415
//

If you have problems or comments...

PBIL Back to PBIL home page