(data stored in ACNUC7421 zone)

EMBL: AE006468.YAFA

AE006468.YAFA        Location/Qualifiers
FT   CDS_pept        363227..364471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafA"
FT                   /locus_tag="STM0318"
FT                   /product="putative hydrolase of the alpha/beta superfamily"
FT                   /note="hypothetical protein in gpt-crl intergenic region.
FT                   (SW:YAFA_SALTY)"
FT                   /db_xref="EnsemblGenomes-Gn:STM0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19274"
FT                   /db_xref="GOA:P37722"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37722"
FT                   /protein_id="AAL19274.1"
FT                   /translation="MTQANLSETLFKPRFKHTETSTLVRRFNRGSQPPMQSALDGKNVP
FT                   HWYRMINRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQ
FT                   AMDWQQKACQEQDAMRSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FT                   LPGSLREMEFAVPGGSPVTAFLHMPKGDGPFPTVLMCGGLDAMQTDYYTLYERYFAPRG
FT                   IAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAVR
FT                   LAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELN
FT                   RYSLKVQGLLGRRCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNFD
FT                   RALQEITDWINHRLC"
     atgacacagg ctaacctcag cgaaaccctg ttcaaacccc gctttaaaca tactgaaacg        60
     tctacccttg tccgtcggtt caatcgtggg tcgcagccgc ccatgcaatc cgcgctggac       120
     ggtaagaacg tcccgcactg gtatcgcatg ataaaccgcc tgatgtggat ttggcgcggc       180
     gttgacccac gagaaatcct tgatgtgcag gcgcgcattg tgatgagcga cgcagagcga       240
     acggatgatg atttatacga tacggtcatc ggttaccgcg gcggcaactg gatttatgag       300
     tgggcaaagc aggcgatgga ctggcagcag aaagcctgtc aggaacagga cgccatgcgc       360
     agcggacgct actggcttca tgcctcaacg ctctataaca ttgccgccta cccgcatttg       420
     aagggcgatg agctggcgga gcaggcgcag gcgttggcga atcgcgccta tgaagaggcc       480
     gcgcagcggt tgccaggctc gttacgtgaa atggaatttg ccgttcctgg cggttcgcct       540
     gtcaccgcgt ttttacatat gccgaaaggg gatggcccgt ttccgacggt gctcatgtgc       600
     ggcggcctgg acgccatgca aaccgactat tacaccctgt atgaacgcta tttcgcgccg       660
     cgcggtatcg cgatgttaac gcttgatatg ccttcggttg gattttcatc aaagtggaaa       720
     ttaacccagg attccagctt gctccatcag catgtgttaa aagcgcttcc taatgtcccc       780
     tgggtggatc atacccgtgt tgcggcgttt ggtttccgtt ttggcgccaa cgttgcggtg       840
     cgtctggcct atctggaagc gccgcgtttg aaagcggtgg cttgcctggg gccggtggtc       900
     catgcgctac ttagcgatcc gcaacgacag agcacggtgc cggagatgta tctggatgtg       960
     ctggccagcc gtctgggtat gcatgatgct tcggatgagg cgctgcgtgt ggagctcaat      1020
     cgctattcgt tgaaagtaca ggggctactg ggcagacgtt gtcctacgcc aatgctttcc      1080
     ggcttctgga aaaacgatcc cttcagcccg gaagaagagt ctcgcttaat tacaacatca      1140
     tcttcagacg gtaagctgat agagatccct tttaacccgg tgtaccgcaa ttttgaccgc      1200
     gcgctgcaag aaattaccga ctggattaat catagattgt gttaa                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page