(data stored in ACNUC7421 zone)

EMBL: AE006468.YAFK

AE006468.YAFK        Location/Qualifiers
FT   CDS_pept        complement(356811..357551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafK"
FT                   /locus_tag="STM0312"
FT                   /product="putative periplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73328.1); Blastp hit to AAC73328.1 (246 aa), 90%
FT                   identity in aa 1 - 246"
FT                   /db_xref="EnsemblGenomes-Gn:STM0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19269"
FT                   /db_xref="GOA:Q7CR54"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:Q7CR54"
FT                   /protein_id="AAL19269.1"
FT                   /translation="MRKIAFFLAMLLMPCVSFAGLLSSSSPVTPVSKEYKQQLMGSPVY
FT                   IQIFKEERTLDLYVKMGEQYQLLDSYKICNYSGGLGPKRRQGDFKSPEGFYSVQRNQLK
FT                   PDSRFYKAINIGFPNAYDRAHGYDGKYLMIHGACVSVGCYAMTDSGIDEIFQFVTAALV
FT                   FGQPSVQVSIYPFRMTDANMQRHKYSYYKDFWAQLKPGYDYFEQTHKPPTVSIVDGRYV
FT                   VSKPLSHEVVQPQLASNYTLSEAK"
     atgcgtaaaa tcgcattttt tcttgcgatg cttctgatgc cgtgcgtctc atttgccggt        60
     ttgctgagca gcagcagccc cgtcacgccg gtcagtaaag agtataagca gcagttaatg       120
     ggctcaccgg tctatattca gatttttaaa gaagagcgca cccttgatct ctacgtcaaa       180
     atgggtgagc aataccagtt gcttgatagc tacaaaattt gcaactattc cggcgggtta       240
     ggcccgaaac gccgtcaggg cgattttaaa agtccggaag ggttttacag cgttcagcgt       300
     aatcaactca aaccagacag ccgtttttat aaggccatca acattggttt tcccaatgcc       360
     tacgatcgcg cgcatggcta tgatggtaaa tatctgatga ttcacggcgc ctgtgtttcc       420
     gtcggctgct atgccatgac cgacagcggc attgatgaga ttttccagtt tgtcaccgcc       480
     gcgctggtct ttggtcagcc gagcgtgcag gtgagtattt atccgttccg gatgaccgac       540
     gccaatatgc agcgtcataa atattcatat tacaaagatt tctgggcgca gctaaaaccc       600
     ggctacgatt attttgaaca gacgcataag ccgccgactg tttctatcgt tgatggacgt       660
     tacgtcgtga gcaaaccgtt gagtcacgaa gtcgttcagc cacagctggc ctcaaattat       720
     acgctctccg aggcaaaata a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page