(data stored in ACNUC7421 zone)

EMBL: AE006468.YAFS

AE006468.YAFS        Location/Qualifiers
FT   CDS_pept        302153..302875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafS"
FT                   /locus_tag="STM0262"
FT                   /product="putative SAM-dependent methyltransferase"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73318.1); Blastp hit to AAC73318.1 (246 aa), 86%
FT                   identity in aa 7 - 244"
FT                   /db_xref="EnsemblGenomes-Gn:STM0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19219"
FT                   /db_xref="GOA:Q8ZRM1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRM1"
FT                   /protein_id="AAL19219.1"
FT                   /translation="MKPARLSQTVVAPGCWGELPWGNYYREALEQQLNPWFAKMYGFHL
FT                   LKIGNLSAEINSEACAVSHQVNVSSQGSPMQVLADPLHLPFADKSVDVCLLAHTLPWCT
FT                   DPHRLLREADRVLIDDGWLVISGFNPLSLMGLRKLVPVLRKTPPYNSRMFTLMRQLDWL
FT                   SLLNFEVLHYSRFHVLPWKKQGGRLLNTHIPALGCLQLIVARKRTIPLTLNPLRHNKSK
FT                   TPIRQTVGATRQYRKPDG"
     atgaaaccgg caaggctctc tcaaactgtc gttgcgcccg gatgttgggg tgagttgccc        60
     tggggcaatt actaccgtga ggcgctggaa cagcagctaa atccgtggtt tgcaaaaatg       120
     tatggtttcc atttgcttaa aatcggtaat ttaagcgcag aaatcaattc cgaagcgtgc       180
     gcggtctccc atcaggtgaa tgtttcatcg caggggtcgc cgatgcaggt tctggccgat       240
     ccgctacatc ttccttttgc agataaatcc gtcgatgttt gtctgctggc gcatactttg       300
     ccgtggtgta ccgacccgca ccgtttattg cgggaagccg accgcgtatt gattgatgac       360
     ggttggctgg tcattagtgg atttaacccg ctgagtttga tggggttacg taaactggta       420
     cccgttttac gtaaaacacc gccctataat agtcggatgt ttacccttat gcggcaactg       480
     gactggctgt ctttactcaa tttcgaagtg ctacattata gccgttttca tgtcttaccc       540
     tggaaaaagc agggggggcg gcttttaaat acgcatatcc cggcgctggg ctgtttacag       600
     cttattgtgg cccgtaagcg gaccatcccg cttacgctta atccgctgcg acataataaa       660
     agtaaaaccc ctatccgcca gaccgttggc gccacccggc aatatcgcaa accggatggc       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page