(data stored in ACNUC7421 zone)

EMBL: AE006468.YAFV

AE006468.YAFV        Location/Qualifiers
FT   CDS_pept        complement(351722..352489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yafV"
FT                   /locus_tag="STM0308"
FT                   /product="putative amidohydrolase"
FT                   /note="similar to E. coli putative EC 3.5. amidase-type
FT                   enzyme (AAC73323.1); Blastp hit to AAC73323.1 (256 aa), 82%
FT                   identity in aa 3 - 255"
FT                   /db_xref="EnsemblGenomes-Gn:STM0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19265"
FT                   /db_xref="GOA:Q8ZRJ8"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRJ8"
FT                   /protein_id="AAL19265.1"
FT                   /translation="MSGLKITLLQQPLVWMDGPANLRHFDRQLELVSGRDVIVLPEMFT
FT                   TGFAMEAANNSLSQDSVITWMQAKARQTDALIAGSAALQTERGAVNRFLLVEPEGKVHL
FT                   YDKRHLFRMADEHQHYAAGDKRIIVQWRGWRILPLICYDLRFPIWSRNRNDYDLALYVA
FT                   NWPAPRSLHWQTLLTARAIENQAYVAGCNRVGTDGNGLHYRGDSRIINPQGDIIATAEP
FT                   HQATRIDADLSLVALQDYREKFPAWRDADPFTL"
     gtgtctggtt tgaaaattac tctgttgcaa caacctttag tctggatgga cggcccggca        60
     aacctgcgtc attttgacag acagctagag ctcgtatctg gccgggatgt gattgttctg       120
     cctgaaatgt ttaccaccgg cttcgcgatg gaggccgcta ataactcact ttcgcaagat       180
     agcgtgatta cgtggatgca ggccaaagcc cgacaaactg acgctctgat tgccggcagc       240
     gcggcgctac aaactgagcg cggcgccgta aatcgcttct tactggttga accggaaggc       300
     aaggttcatc tctatgataa gcgccatctg tttcgtatgg cggatgaaca tcaacattat       360
     gccgcaggcg ataaacgcat catcgtgcag tggcgcggtt ggcgcattct gccgctgatc       420
     tgttacgatc tgcgctttcc gatatggtcg cgcaaccgca atgattacga tctggcgctg       480
     tatgtagcga actggcctgc gccgcgctcg ctacactggc aaacattact gacggcgcgc       540
     gctattgaaa atcaggctta tgtcgcaggc tgcaaccggg ttggcaccga tggtaacggg       600
     ctacattatc gcggcgatag ccggatcatt aatccccagg gcgacattat cgccaccgcc       660
     gaaccacacc aggcgacacg tatcgatgcc gatctttctc tcgtcgcctt gcaggactat       720
     cgcgaaaaat ttccagcctg gcgcgatgcc gatccattca ccttgtaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page