(data stored in ACNUC7421 zone)

EMBL: AE006468.YAIA

AE006468.YAIA        Location/Qualifiers
FT   CDS_pept        441418..441609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiA"
FT                   /locus_tag="STM0389"
FT                   /product="putative cytoplasmic protein"
FT                   /note="similar to E. coli orf, hypothetical protein
FT                   (AAC73492.1); Blastp hit to AAC73492.1 (63 aa), 93%
FT                   identity in aa 1 - 62"
FT                   /db_xref="EnsemblGenomes-Gn:STM0389"
FT                   /db_xref="EnsemblGenomes-Tr:AAL19343"
FT                   /db_xref="InterPro:IPR032303"
FT                   /db_xref="InterPro:IPR038462"
FT                   /db_xref="UniProtKB/TrEMBL:Q8ZRE9"
FT                   /protein_id="AAL19343.1"
FT                   /translation="MPTRPPYPREAYIVTIEKGTPGQTVTWYQLRADHPKPDSLISEHP
FT                   TAEEAMDAKNRYEDPDKS"
     atgccaacca gaccacctta tccgcgggaa gcttatatcg tcaccattga aaaaggcacg        60
     ccgggccaga cggtgacgtg gtatcagcta cgggctgacc atccgaaacc tgattcgctc       120
     atcagcgagc atccgaccgc agaagaagcg atggatgcga aaaatcgtta cgaagatccg       180
     gataaatcat ag                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page